KEGG   Shewanella woodyi: Swoo_4739Help
Entry
Swoo_4739         CDS       T00676                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
swd  Shewanella woodyi
Pathway
swd00250  Alanine, aspartate and glutamate metabolism
swd00410  beta-Alanine metabolism
swd00430  Taurine and hypotaurine metabolism
swd00650  Butanoate metabolism
swd01100  Metabolic pathways
swd01110  Biosynthesis of secondary metabolites
swd01120  Microbial metabolism in diverse environments
swd02024  Quorum sensing
Module
swd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:swd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Swoo_4739
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Swoo_4739
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Swoo_4739
   00430 Taurine and hypotaurine metabolism
    Swoo_4739
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Swoo_4739
Enzymes [BR:swd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Swoo_4739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ACA88989
UniProt: B1KN32
LinkDB All DBs
Position
complement(5719039..5720433)
Genome map
AA seq 464 aa AA seqDB search
MPLHSKDTVRDDLLDDIYSSADLALSMPKYKMPEQEHDSRHVYQVIHDELMMDGNSRQNL
ATFCQTWVEDEVHKLMDECIDKNMIDKDEYPQTAELEARCVHMLADLWHSPDAENTLGCS
TTGSSEAAMLGGMALKWAWREKMRKLGKPTDKPNLICGPVQVCWHKFARYWDIELREIPM
EGDRLIMTPEEVIKRCDENTIGVVPTLGVTFTCQYEPVKAVHEALDQLQKDTGLDIPMHI
DAASGGFLAPFCDPDLEWDFRLPRVKSINASGHKFGLSPLGVGWVIWRDASALDKDLIFN
VNYLGGNMPTFALNFSRPGGQIVAQYYNFLRLGREGYRKIHQACYDTAIYLSGEIEKMGM
FDIIYDGQGGIPAMSWSLKEGVEPGFNLFDLSDRIRSRGWQIAAYAMPPKREDLVIMRIL
VRHGFSRDQADLLVADLQHCVDFFAKHPISHSSDEAESAGFNHG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttcattccaaggatacggttagagatgaccttctcgatgacatctactcgtca
gctgacctggccctatctatgccaaagtacaaaatgcctgaacaggaacatgactctcgc
catgtttatcaggttattcacgatgaactcatgatggacggtaactcgcgacagaatctg
gcgacattttgtcagacttgggtcgaagatgaagtgcacaagctgatggatgaatgtatc
gataagaatatgatcgataaagatgaatatcctcagacggctgagcttgaggctcgctgt
gtgcatatgttggcagatctgtggcactcaccggatgcggagaacaccttaggttgctcc
acaacgggttcgagtgaagccgccatgttaggtggaatggcgctgaaatgggcttggcgt
gaaaagatgagaaagctaggtaagccaacggataagccaaatttaatctgtggtccagtg
caggtgtgttggcataagtttgctcgctactgggatattgagctacgtgagatcccgatg
gagggtgatcgcctcatcatgacgcctgaagaggtgattaaacgctgtgatgaaaacacc
ataggtgtagtgcccacacttggtgttacctttacctgccaatatgagccagttaaggcg
gtacatgaagccttagatcagctacaaaaagacactggcttagatatccccatgcatatt
gatgctgccagtggtggtttcttagcaccattttgcgatccagaccttgagtgggacttc
cgcttgcctcgagttaagtctattaatgcttccggacataagtttggtttgagcccgtta
ggggtgggctgggtgatctggcgtgatgcgtcagcactggataaagatcttatcttcaat
gtgaactatctaggtggcaatatgccgacctttgcattgaacttctcccgtcctggcggt
cagatcgtggcgcaatattacaactttttgcgtttaggccgagagggatatcgcaagata
catcaagcttgctatgacactgcgatctacctctcaggagagatcgagaagatggggatg
tttgacattatctatgatggccaaggtggtattcctgccatgagttggtcgttgaaagag
ggggttgaaccaggctttaacctatttgacctttccgatcggatccgctcccgtggttgg
caaattgccgcctatgcgatgccgccaaagcgggaagatttagtgattatgcgtatctta
gttcgtcatggctttagtcgggatcaagccgatctcttggtggccgatctgcagcattgt
gtcgacttttttgcaaaacatcctatttcacatagcagtgatgaagcggaatctgcaggt
ttcaatcacggttag

DBGET integrated database retrieval system