KEGG   Swingsia sp. F3b2: E3E12_05240
Entry
E3E12_05240       CDS       T06093                                 

Definition
(GenBank) NAD(P)/FAD-dependent oxidoreductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
swf  Swingsia sp. F3b2
Pathway
swf00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:swf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    E3E12_05240
Enzymes [BR:swf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     E3E12_05240
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like FAD_binding_2 Thi4 FAD_oxidored K_oxygenase NAD_binding_8 DAO FAD_binding_3 FMO-like DUF43
Other DBs
NCBI-ProteinID: QDH13690
UniProt: A0A4Y6U9I7
LinkDB
Position
complement(1186920..1187972)
AA seq 350 aa
MSEHTQNAPQGSPRKLEADVAIVGAGPVGLFAAFQCGMLGLSCALADVLEVPGGQCVALY
PEKPIYDIPSRPSITGGGLIEALLEQVSPFNPAMLLGSRISDVAGKAGAFTLTNERGDSI
AAKAIIVAAGAGAFGPNRPPLEGLEAYESTGAVQYFVKKRADFADKTIVVAGGGDSALDW
ALSLSEIAKHVYLLHRRDRFRGAPDTLARIEKRISEGKIEKVVPYQLSALQGEEGHLRQV
EVKTLKGEARLLDADHLLPFYGLSTDLGPIALWGFNTERSSVPVNPATMETTTPGIYAIG
DVAHYPGKMKLILQGFSEAAMATHAAYAVARPDEALRFEHSSNRSSRPGA
NT seq 1053 nt   +upstreamnt  +downstreamnt
gtgagcgaacacacccagaatgccccccagggcagcccccgtaagcttgaagcagacgtg
gccattgtgggcgctggccctgtggggcttttcgcagctttccagtgcggcatgctgggg
ctttcctgtgcgctggctgacgtgcttgaggtgcctggtgggcaatgtgttgccctttac
cctgaaaagcccatctacgacattccctcccgtccctccatcacgggtggcggcttgatt
gaggccctgctggagcaagtgtcccccttcaatccagccatgctgctgggcagccgcatc
agcgacgttgccggcaaggctggcgctttcaccctgaccaatgaacgcggcgacagcata
gcggccaaggccatcatcgtggccgctggcgctggcgcctttggccccaaccgccctccc
ttggagggattggaagcttacgaaagcacaggtgccgttcagtacttcgtcaaaaaacgg
gctgacttcgccgacaaaaccattgtcgtggctggggggggcgattcagcgctggattgg
gcgctgtcgctttcagagatcgccaagcatgtctacctgctgcacaggcgcgaccgcttc
cgtggcgcgccagacacccttgcccgcattgagaaacgcatcagcgaaggcaagattgaa
aaggttgtcccctaccagctcagcgctctccagggggaagaggggcatctgcggcaagtg
gaggtcaaaaccctcaaaggggaggcacgcctgcttgacgcagaccacctgctgcccttt
tacggcctttccactgacctggggcccattgcgctgtggggcttcaacacggaacgctcc
tccgtccccgtgaaccccgccaccatggaaaccaccacgcctggcatttacgccattggt
gacgtggcgcattatccaggcaaaatgaagcttatcctgcagggcttctctgaagcggcc
atggccacccatgccgcttacgctgtggcgcgccctgacgaagcactgcgctttgaacat
tcaagcaaccgcagcagccgtccaggcgcctga

DBGET integrated database retrieval system