KEGG   Swingsia sp. F3b2: E3E12_08210Help
Entry
E3E12_08210       CDS       T06093                                 

Gene name
ruvX
Definition
(GenBank) Holliday junction resolvase RuvX
  KO
K07447  putative holliday junction resolvase [EC:3.1.-.-]
Organism
swf  Swingsia sp. F3b2
Brite
KEGG Orthology (KO) [BR:swf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E3E12_08210 (ruvX)
Enzymes [BR:swf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     E3E12_08210 (ruvX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvX
Motif
Other DBs
NCBI-ProteinID: QDH14178
UniProt: A0A4Y6UC81
LinkDB All DBs
Position
1857876..1858355
Genome map
AA seq 159 aa AA seqDB search
MALFNPHDLRPLLPPGTRLLGVDPGKRQIGLALSDVSLTLASPLLTLKRGKMAQNVVELE
NLVHRHGIGGLVVGLPLSLDGDFGPAARAAHDWGGDIAERLGLPCALWDERLSSSAVNRF
LIQEADASRAKRAEVVDKMAAAYILQAFLDATATDKPNI
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctttgttcaatccacacgacctccgcccgctcctcccccccggcacgcgcttgctg
ggggttgaccctggcaaacgccaaatcggcctggcgctttctgacgtctccctcacgctg
gcttcgccgctgcttaccctcaagcggggcaaaatggcgcaaaacgtggttgagctggaa
aacctagtgcaccgccacggcattggcgggcttgtggtggggctgcccctttcgcttgat
ggcgactttgggcctgctgcgcgcgcagcccatgattgggggggggacatcgctgagcgt
ctgggcctgccctgcgcgctgtgggatgagcgtctgtcctcaagcgctgtcaaccgcttc
ctcatccaggaggcggacgctagccgcgccaaacgcgctgaggtggtggacaaaatggcg
gctgcctacatcctccaggcgtttctggatgcgaccgctacagataagcccaatatataa

DBGET integrated database retrieval system