KEGG   Sphingomonas wittichii: Swit_0286Help
Entry
Swit_0286         CDS       T00538                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
Organism
swi  Sphingomonas wittichii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABQ66657
UniProt: A5V2Z1
LinkDB All DBs
Position
302847..303860
Genome map
AA seq 337 aa AA seqDB search
MRAAIFHGAGKPMTIEDVPDPEPGPGEAVIKVCRCGICGSDIGMTSGSHADYPAGTTLGH
EYAGEVVAVGRDVSNLKVGQRVSAMPAKGCGRCASCLAGFPLGCTAMAGMIGGFGQYMRI
YAPAAIHLPDTLSMADGALVEPLAVGLRGVALAGLRPGATVAVLGAGAVGLAAIYWARLL
GAGRIVAMSRSARRADLATAMGADGFEAFGEGEGDRLAAALGGLPDAVLECAGAVGLMQK
AVELVRPGGTIVSLGFCGSPDPIIPSLATWKQVTMKFSFAYDLREFQHCADALDAGHVAP
RMMVSETIGLDALPSGFEALRTGSTQTKVHVDPWIAA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgggccgccatattccacggcgcgggcaagccgatgacgatcgaggacgtgcccgat
cccgagcccggccccggcgaggcggtgatcaaggtgtgccgctgtggcatctgcggctcc
gacatcggcatgacgtcgggcagccatgccgattatcccgccggcaccaccctgggccat
gaatatgccggcgaggtcgtcgcggtcggcagggacgtgtcgaacctcaaggtcggccag
cgcgtctcggcgatgccggccaagggctgcgggcgctgcgcctcctgcctggccggcttt
ccgctgggctgtaccgcgatggcggggatgatcggcggtttcggccaatatatgcggatc
tacgcgcccgccgcgatccacctgcccgatacgctgtcgatggccgacggcgcgctggtc
gagccgctcgcggtcggcctgcgcggcgtcgccctggccgggctcaggcccggcgcgacg
gtcgcggtgctcggcgcgggcgcggtggggcttgctgcgatttactgggcgcggctgctc
ggcgccgggcgcatcgtcgccatgtcgcgctcggcgcggcgggccgacctcgccacggcg
atgggcgccgacggcttcgaggcgttcggcgaaggcgagggcgaccggctggcggcggcg
ctgggcggcctgcccgacgcggtgctcgaatgtgccggcgcggtcggcctgatgcagaag
gcggtcgagttggtgcggcccggcggcacgatcgtctcgctcggcttctgcggcagcccc
gatccgatcatcccgtcgctcgccacctggaagcaggtgacgatgaaattctccttcgcc
tacgacctgcgcgagttccagcattgcgccgatgcgctcgacgccggccatgtcgcgccg
cgcatgatggtcagcgagacgatcgggctcgacgcgctgccgtcgggcttcgaggcgctg
cgcaccggatcgacccagaccaaggtgcatgtcgacccctggatcgccgcatga

DBGET integrated database retrieval system