KEGG   Sphingomonas wittichii: Swit_0382Help
Entry
Swit_0382         CDS       T00538                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
swi  Sphingomonas wittichii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABQ66752
UniProt: A5V386
LinkDB All DBs
Position
407327..408802
Genome map
AA seq 491 aa AA seqDB search
MTDTLLNLSNPEKLFIGGDWAASSDDGGIEIVSPSTEEVVGRVGKAGRADMDRVVAVARH
AFDHGPWPRMTGAERAAVLRRIAGEMGKRADDFARAWSLQVGMPYAQSSMTAPYMAAYLT
YFADLAEKGFEEVRQPMMGGHCIVVHEPVGVVAAVVPWNAPLATLLLKVAPALAAGCAVI
AKPSPETPLEALILAECIAAAGVPEGVFSVLTADREVSDHLIRNPGIDKVSFTGSTAAGL
HIASVCGGRMARVTTELGGKSAAIVLDDATIETVVAGIMPNLVGLCGQQCAAFSRILVPA
ARKAEVTEAMAAAMQAVTVGDPFDQATQMGPLVTRNQHGRVFGYIEKGKAEGARLVTGGG
RPAHLPKGWFVEPTLFADASNDMAIAREEIFGPVGTIIAYDDEEQAIAIANDSNYGLSGG
VFTESPDRAYAVARRIRTGNFGHNGRVIDFTMPYGGFKQSGIGREGGIEGLYAFTETKAV
FMPKLPTHLRS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacgctgctgaacctctccaaccccgaaaagctgttcatcggcggcgactgg
gcggcctcgtcggacgatggcgggatcgagatcgtctcgccctcgaccgaggaggtggtc
ggccgtgtcggcaaggcgggcagggcggacatggatcgcgtcgtcgctgtggcgcgccat
gccttcgatcacggtccctggccgcgcatgaccggcgccgagcgcgccgccgtgctgcgc
cggatcgccggggagatgggcaagcgcgccgacgatttcgcgcgcgcctggtcgctccag
gtcggcatgccctatgcccagtcgtcgatgaccgcgccttacatggccgcctatctcacc
tatttcgccgacctcgccgaaaaggggttcgaggaggttcgccagccgatgatgggcggc
cattgcatcgtcgtccatgagccggtcggtgtcgtcgcggcggtggtgccgtggaacgcg
ccgctggcgacgctgctgctgaaggtcgccccggcgctggcggcgggctgcgccgtcatc
gccaagccctcgcccgagaccccgctggaggcgctgatcctcgccgaatgcatcgcggcg
gccggcgtgcccgagggcgtcttctcggtgctcaccgccgaccgcgaggtttccgatcac
ctgatccgcaaccccgggatcgacaaggtcagcttcactggatcgaccgccgccgggctg
cacatcgcttcggtctgcggcggccgcatggcgcgcgtcaccaccgaactgggcggcaag
tccgccgcgatcgtcctcgacgacgcgacgatcgagacggtggtcgccgggatcatgccc
aacctggtcggcctgtgcggccagcaatgcgccgccttcagccgcatcctcgtccccgcc
gcgcgcaaggccgaggtgaccgaggcgatggccgccgcgatgcaggcggtgacggtcggc
gatccgttcgaccaggcgacccagatgggcccgctcgtcacccgcaaccagcatggccgg
gtgttcggctatatcgagaagggcaaggccgagggcgcccgcctcgtcaccggcggcggg
cggccggcgcacctgcccaagggctggttcgtcgagccgaccctgttcgccgacgcgagc
aacgacatggcgatcgcgcgcgaggagattttcgggccggtcggcacgatcatcgcctat
gacgacgaggaacaggccatcgccattgccaacgacagcaattatggcctgtccggcggc
gtgttcaccgaaagccccgaccgcgcctatgccgtcgcgcggcgtatccgcaccggcaat
ttcgggcataatggccgggtgatcgacttcaccatgccctatggcggcttcaagcagtcg
gggatcggccgcgagggcgggatcgaggggctgtacgccttcaccgagaccaaggcggtc
ttcatgcccaaactcccgacgcatctgcggtcatga

DBGET integrated database retrieval system