KEGG   Sphingomonas wittichii: Swit_0887Help
Entry
Swit_0887         CDS       T00538                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
swi  Sphingomonas wittichii
Pathway
swi00970  Aminoacyl-tRNA biosynthesis
swi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Swit_0887
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:swi03029]
    Swit_0887
Enzymes [BR:swi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Swit_0887
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Swit_0887
Mitochondrial biogenesis [BR:swi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Swit_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABQ67254
UniProt: A5V4N8
LinkDB All DBs
Position
complement(977676..979034)
Genome map
AA seq 452 aa AA seqDB search
MPGKDGAVSARLSHVLDLIAAGAVPAERAYTHILAGTARGEARAADGRADRGEAIGALDG
ALVSVKAMLDVQGLLTDAGSATLRGRPPAASDSSVVSRLRSAGAVVVGTTQMTEFAFSAV
GTNPNFPALGNPHDAERICGGSSSGAAVSVGGGLADIAIGSDTGGSLRIPAALCGLVGFK
PTASRVPAAGSFPLSQTLDSIGPIARSVKLCALADSVLATGKASDVAAIGVDRFRLVVAR
GRLFEGCDQAVLDAFDGAIDHLRRSDVRISDGSLEPILDELARIDGLGTFPPVELAATLR
SSGITDLAPVDPNTRSRIEAGSGLSAVDYLEMARLRRQLADGFERSMEDGEVYVVPTVPI
VAPTTSSVSDPEQFRRINALLLRNPRVANLLDCPSISIPLPSRGLPVGMMLIGRRNADRH
LLSIALRLEGILAQGDRLCREDGLGIAGEGRI
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcaaggacggcgccgtctcagcgcgactgagccatgtcctggacctgatcgcc
gcaggtgcggtcccggccgagcgcgcctatacgcatatcctggcgggtacggcgcgcggc
gaggcccgcgcggccgacggccgcgcggatcggggcgaagcgatcggcgcgctcgacggc
gccctggtttccgtcaaggcgatgctggacgtgcagggactcctgaccgatgcggggtcc
gccaccctgcgcggacggccgccggccgcgagcgacagcagcgtggtgtcacggcttcgg
tctgcgggcgccgtcgtcgtcggcacgacgcagatgacggagttcgccttttcggcggtg
ggcaccaatcccaatttccccgccttgggcaatccccatgacgcggagcggatttgcgga
gggtcgtcgtcgggtgcggcggtttcggtcggcgggggcctggcggacatcgccatcggc
agcgatacgggcggctcgctgagaatcccggcggccctttgcggcctggtcggtttcaag
ccaacggcttcgcgggttccggcggccggcagcttccccttgtcgcagacgctcgattcg
atcggccccatcgctcgatcggtgaagctttgcgccctggcggattcggtccttgccacg
ggcaaggcatcggacgtcgcggccatcggcgtggatcgcttccggctggtcgtcgcccgt
gggaggctgttcgagggttgcgaccaggcggtgctcgacgccttcgacggcgcgatcgat
cacctgcggcgatcggacgtccggatctcggacggatcgctggaaccgatcctcgacgaa
ctggcccggatcgatgggctcggcacgttcccgccggtcgaactggccgcgaccctgcgc
agcagcggcatcaccgatctggcgccggtcgaccccaacacgcggagccggatcgaagcc
ggcagcggcttgtcggccgtcgattatctggagatggcgcgcctgcggcgtcaactggcc
gacgggttcgagcggtcgatggaggacggggaggtatatgtcgtccccacggtcccgatc
gtcgcgccgacgacgtcgtcggtcagcgatccggagcagttccgacggatcaacgccttg
ctgctccgcaatccgcgggttgccaatctgctcgattgcccctccatctcgataccgctt
cccagccggggcctgccggtcgggatgatgctgatcggacggcggaacgccgatcggcat
ctcctgtcgatcgcgttgcggctggaaggcattctcgcccagggcgaccggctatgtcgg
gaggacggattggggatcgctggcgaggggaggatttga

DBGET integrated database retrieval system