KEGG   Sphingomonas wittichii: Swit_2227Help
Entry
Swit_2227         CDS       T00538                                 

Definition
(GenBank) Pyrrolo-quinoline quinone
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
swi  Sphingomonas wittichii
Brite
KEGG Orthology (KO) [BR:swi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Swit_2227
Enzymes [BR:swi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     Swit_2227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ABQ68586
UniProt: A5V8H0
LinkDB All DBs
Position
2482495..2484612
Genome map
AA seq 705 aa AA seqDB search
MKLIPWRGRRAVIRTTLAGLIAPALVAASLAGGTPPRDWQLETAYHYPGTQVDAATAGRL
GVAWEFDDFVVRGSTHRGVEATPVVVDGVMYLTGPWSVVYALDARTGKPLWQYDPEVDGQ
FARRTCCDAVNRGVAVADGVVYVAALDGWLAAVDARTGKELWKVDTITDRKMSYAITGAP
RVAGRNVVIGNGGGEMGARGYASAYDRKTGKLAWRFFVVPGDPAKGADEHPEVTEARKTW
DPKSRWDLGGGGTPWDSIVYDPDTNIVYVGTGNGMPHPSWLRSPAGGDNLYLSSIVAIDA
DTGRKKWHYQTTPADSWDYTATQNMILADIEIGGRPRKVIMQAPKNGFFYVLDRVTGELL
SAEKFTTVTWADRVDMKTGRPVVSDQSDYSRKTKLVWPSEAGGHNWQPMSYSRETGLVYI
PVLEAPMTFQMLEQPKYRPYSNLQGSAASFPSFAFGSNKTGGAEDILAGQPRPTFQQIVR
AWDPVRQKEAWATKPMPFWSGGTMVTGGLVFQGSADGWLTAYDARTGAVVHRVDVGTGIM
ASPMSYTIDGVQYVAVTAGIGGALNVSYPPGAVAIERQNSERLIVFRIGGPAPRLPPLRE
ARPFTVAPAQYRGTQAQEQHGAALYGENCGRCHGGPTGAGGYPNLWKMTPETHAAFESIV
LDGAFAYAGMASFADVLSKQDARDIHAFLAKPHDEKAQPTENRMH
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgatcccatggcgcggtcgccgcgccgtcatccggacgacgctggcgggcctg
atcgccccggcgctggtcgccgccagcctggcgggcggcacgccgccgcgcgactggcag
ttggagaccgcctatcattatccgggcacgcaggtcgacgcggcgaccgccggccggctg
ggcgtcgcctgggagttcgacgatttcgtcgtgcgcggcagcacccatcgcggggtcgag
gcgaccccggtcgtggtcgacggggtgatgtacctgaccgggccgtggagcgtggtctac
gcgctcgacgcgcgcaccggaaagccgctctggcaatatgatccggaggtcgacggccag
ttcgcccgccgcacctgctgcgacgcggtcaatcgcggcgtcgcggtcgccgacggcgtg
gtctatgtcgccgcgctcgacggctggctggcggcggtcgacgccaggaccggcaaggag
ctgtggaaggtcgacacgatcaccgaccgcaagatgagctatgcgatcaccggcgcgccg
cgcgtcgcgggcaggaacgtcgtgatcggcaatggcggcggcgagatgggcgcgcggggc
tatgccagcgcctatgaccgcaagaccggcaagctcgcctggcgcttcttcgtcgtgccg
ggcgatcccgccaagggcgccgacgagcatcccgaggtgaccgaggcgcgcaagacctgg
gaccccaagtcgcgctgggacctgggcggcggcggcacgccgtgggattcgatcgtctac
gatcccgacaccaacatcgtctatgtcggcaccggcaacggcatgccgcacccgtcctgg
ctgcgcagcccggccggcggcgacaatctctatctgtcctcgatcgtcgcgatcgacgcc
gacaccggccgcaagaagtggcattaccagaccacacccgccgacagctgggactatacc
gcgacccagaacatgatcctcgccgacatcgagatcggcggccgcccgcgcaaggtgatc
atgcaggcgccgaagaacggcttcttctacgtgctcgaccgggtgaccggcgaactgctg
tcggcggagaagttcaccaccgtcacctgggccgaccgcgtcgacatgaagaccggccgg
ccggtggtcagcgaccagtcggactattcgaggaagaccaagctggtctggccgtcggag
gccggcgggcacaattggcaacccatgtcgtacagccgggaaaccgggctggtctacatc
ccggtgctcgaggcgccgatgaccttccagatgctggagcaaccgaaataccggccctac
agcaacctgcagggctcggccgcctccttccccagcttcgccttcggatcgaacaagacc
ggcggcgccgaagacattctcgccggccagcccaggccgaccttccagcagatcgtccgc
gcctgggacccggtgcgccagaaggaggcctgggcgacgaagccgatgcccttctggagc
ggcggcacgatggtgaccggcgggctcgtcttccagggttcggccgacggctggctgacc
gcctatgacgccaggaccggcgccgtggtccaccgcgtcgatgtcggcaccggcatcatg
gcatcgccgatgagctacacgatcgacggcgtccaatatgtcgcggtgacggccggcatc
ggcggcgccctcaacgtgtcctacccgcccggcgcggtggcgatcgagcggcagaacagc
gagcggctgatcgtgttccggatcggcggccccgcgcccaggctgccgccgctgcgcgag
gcccggccgttcaccgtggcgcccgcccaatatcgcggcacccaggcccaggagcagcac
ggcgccgccctctacggcgagaattgcgggcgctgccacggcgggccgaccggcgcgggc
ggctatcccaacctgtggaagatgacgcccgagacgcatgccgcgttcgagtcgatcgtc
ctcgacggcgccttcgcctatgcgggcatggcctccttcgccgacgtgctgagcaagcag
gacgccagggacatccacgccttcctggcgaagccgcacgacgagaaggcccagcccacc
gagaaccggatgcactaa

DBGET integrated database retrieval system