KEGG   Sphingomonas wittichii: Swit_3135Help
Entry
Swit_3135         CDS       T00538                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
swi  Sphingomonas wittichii
Pathway
swi00620  Pyruvate metabolism
swi00680  Methane metabolism
swi01100  Metabolic pathways
swi01120  Microbial metabolism in diverse environments
swi01200  Carbon metabolism
Module
swi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Swit_3135
  Energy metabolism
   00680 Methane metabolism
    Swit_3135
Enzymes [BR:swi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Swit_3135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase ACT_5
Motif
Other DBs
NCBI-ProteinID: ABQ69483
UniProt: A5VB17
LinkDB All DBs
Position
3447062..3449851
Genome map
AA seq 929 aa AA seqDB search
MPAFAGMTVERLSGQTPAAATSFSVDRAFIASQHRAMSSTPPITQNPDIRFLGRLLGDVI
RVYGGEALFRRIEYIRSASVDRARGIVGSHEIDSGLGALTLDDTLAFVRGFMLFSMLANL
AEDRQGIAAEPGADVAAALDRLEKEGISRAKVVEMLDRALIVPVLTAHPTEVRRKSMIDH
RNKIAELMTLKDIGRTETVDGDLIDQAIYRQIALLWQTRPLRRERLYVADEVETALAYLR
DIFLPTLPALYSRWQRALGHRPASFLKPGSWIGGDRDGNPFVTADSLRLALSRSAETVIG
YYLRELHELGAELSISTELAEVTWEVEKLAEASGDKSSTRSDEPYRRAITGIYSRLSKTY
EKLTGRLPARLPATDAEGGAYEDPAALRADLVEIAHALNRTGADSLAGNGALGRLIRAVE
TFGFHLATLDMRQNADVHERVVADLLRVAGVEADYGALDEPARVALLRSELASKRLLRTP
FGAYADETLSELAIVEAAAEAHRRYGPAAITTYLISKAESVSDMLEVNILLKEAGLFVPG
DPPTAAIMAVPLFETIGDLDRAPEVMTQWFALPEVAAITAARGHQEVMVGYSDSNKDGGY
LTSVWSLHEASSALKPVFAKANSAIQLFHGRGGAVGRGGGSSFAAILAQPHGTVQGRIRI
TEQGEVIAAKYGTRESAAANLEAMASATLLATLEEDALQPKDAKRFFAAMDEISANAFKA
YRGLVYDTEGFRTFFRQMTPIAEIADLKIGSRPASRTKSDRIEDLRAIPWVFSWAQARVM
LPGWYGVGHGLKGFKDIGLLREMLEAWPFFQSTLANLEMVLAKSDMDIAERYVALVEDEA
MGRDIFGRIRDGWQRTQEALLSVTRQTRLLQKNPSLDQSIRLRLPYIEPLNLLQIELLKR
HRAGEDDPRVREGIQLSINAIATALRNSG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgccagccttcgctggcatgacggttgagaggttgagcggccaaactccggccgccgcg
acgtcattttccgttgaccgggcttttattgcgtcgcagcatcgtgcgatgtccagcacg
ccgcccatcacccagaaccccgacatccgcttcctcggccgcctgctcggcgacgtgatc
cgcgtctatggcggcgaggcgctgttccggcggatcgaatatatccgctcggcgtcggtc
gatcgggcgcgcggaatcgtcggctcgcacgagatcgattcggggctcggcgcgctgact
ctcgacgacacgctcgccttcgtgcgcggcttcatgctcttctcgatgctcgccaacctc
gccgaggaccggcagggcatcgccgccgagcccggcgccgacgttgccgccgcgctcgac
cggctggagaaggaaggcatctcgcgcgccaaggtggtcgagatgctcgaccgggcgctg
atcgtgccggtgctcaccgcccatccgaccgaggtgcggcgcaagagcatgatcgaccat
cgcaacaagatcgccgagctgatgacgctcaaggacatcggccggaccgagaccgtcgac
ggcgacctgatcgaccaggcgatctaccggcagatcgcgctgctctggcagacccggccg
ctgcgccgcgagcggctctatgtcgccgacgaggtggagaccgcgctcgcctatctgcgc
gacatcttcctgccgacgctccccgcgctctattcgcgctggcagcgcgcgctcggccac
cgtccggcgagcttcctgaagccgggaagctggatcggtggcgatcgcgacggcaacccc
ttcgtcaccgccgattcgctgcgcctggctttgtcgcgctcggccgagacggtgatcggc
tattatctgcgcgagctgcacgagctgggcgccgagctgtcgatctcgaccgagctggcc
gaggtgacctgggaggtcgagaagctcgccgaggcgtcgggcgacaagagctcgacccgc
agcgacgagccctatcgccgcgcgatcaccggcatctattcgcgcctgtccaagacctat
gagaagctgaccggccgcctgccggcgcggctgccggcgaccgatgccgagggcggcgcc
tatgaggaccccgccgcgctgcgcgccgacctggtcgagatcgcccatgcgctcaaccgc
accggcgccgactcgctcgccggcaacggcgcgctcggccggctgatccgcgccgtcgag
accttcggcttccatctcgcgacgctcgacatgcgccagaatgccgacgtccacgagcgc
gtcgtcgccgacctgctcagggtcgccggggtcgaggccgactatggcgcgctcgacgag
cccgcgcgcgtcgcgctgctgcggagcgaactggcgtcgaagcggctgctgcgcaccccg
ttcggcgcctatgccgacgagacgctgtccgagctcgcgatcgtcgaagccgccgccgag
gcgcatcgccgctacgggcccgcggcgatcaccacctatctgatctcgaaggccgagagc
gtgtcggacatgctcgaggtcaacatcctgctcaaggaggccgggctgttcgtccccggc
gatccgcccaccgccgcgatcatggcggtgccgctgttcgagacgatcggcgacctcgac
cgcgcgcccgaggtgatgacgcagtggttcgcgctgcccgaggtggcggcgatcaccgcc
gcgcgcggccatcaggaggtgatggtcggctattcggattcgaacaaggacggcggctac
ctcacctcggtgtggagcctgcacgaggcgtcgagcgcgctgaagccggtgttcgccaag
gcgaacagcgcgatccaactcttccacggccgtggcggcgcggtcgggcgcggcggcggg
tcgagcttcgcggcgatcctcgcccagccgcacggcacggtgcagggccgcatccgcatc
accgagcagggcgaggtgatcgccgccaaatatggcacgcgcgagagcgccgccgccaat
ctggaggcgatggcctcggccacgctgctcgccacgctggaggaggatgcgctccagccc
aaggacgccaagcgcttcttcgccgcgatggacgagatctcggccaatgcgttcaaggcc
tatcgcggcctggtctatgacaccgagggcttccgcaccttcttccgccagatgacgccg
atcgccgagatcgccgacctcaagatcgggtcgcgcccggcgagccggaccaagagcgac
cggatcgaggacctgcgcgccatcccctgggtgttcagctgggcgcaggcgcgggtgatg
ctgcccggctggtacggcgtcggccacggcctcaagggcttcaaggacatcggcctgctg
cgcgagatgctggaggcctggcccttcttccagtcgaccctcgccaatctggagatggtg
ctcgccaagtcggacatggacatcgccgagcgctatgtcgcgctggtcgaggacgaggcg
atgggccgcgacatcttcggccgcatccgcgacggctggcaacggacgcaggaggcgctg
ctatcggtgacgcggcagacccgcctgctccagaagaacccgtcgctcgaccagtcgatc
cggctgcgcctgccctatatcgagccgttgaacctgctccagatcgagctgctcaagcgc
caccgcgcgggcgaggacgacccccgcgtccgcgagggcatccagctctcgatcaacgcg
atcgcgaccgcgctgcgcaacagcgggtga

DBGET integrated database retrieval system