KEGG   Sphingomonas wittichii: Swit_3943Help
Entry
Swit_3943         CDS       T00538                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
swi  Sphingomonas wittichii
Pathway
swi00473  D-Alanine metabolism
swi00550  Peptidoglycan biosynthesis
swi01100  Metabolic pathways
swi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:swi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Swit_3943
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Swit_3943
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Swit_3943
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:swi01011]
    Swit_3943
Enzymes [BR:swi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Swit_3943
Peptidoglycan biosynthesis and degradation proteins [BR:swi01011]
 Precursor biosynthesis
  Amino acid ligase
   Swit_3943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ABQ70288
UniProt: A5VDC2
LinkDB All DBs
Position
complement(4329234..4330172)
Genome map
AA seq 312 aa AA seqDB search
MTHPLHIAVLMGGWSSEREVSLTSGNGVADALESLGHKVTRIDMDRDVALRLAEAKPDVV
FNALHGTPGEDGTVQGMMDLMGLTYTHSGLTTSVIAIDKELTKQQLVPHGIRMPEGIIVE
SESLHAGDPMPRPYVLKPVNEGSSVGVAIIKERDNHGVPIHRDSHGPWQTFATLLAEPFI
RGRELTVAVLGNRALGVTELVPSSGFYDYEAKYTDGLTTHICPADVPADIAEAAMRMALD
AHRLLGCKGTSRSDFRWDDERGEAGLYLLEVNTQPGMTPLSLVPEQARHVGLTYADLVQA
IVDEALAGKAAR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgacccatcccctccacatcgcggtgctgatgggcggctggtcgtcggagcgcgaggtg
tcgctgacctcgggcaacggcgtcgccgacgcgctcgagagcctgggtcacaaggtgacg
cggatcgacatggaccgcgacgtcgcgctgcgcctggccgaggcgaagcccgacgtggtg
ttcaacgcgctgcacgggacgccgggcgaggacggcaccgtccagggcatgatggacctg
atggggctgacctacacccattcggggctgaccacctcggtcatcgcgatcgacaaggag
ctgaccaagcagcagctcgtcccccacggcatccgcatgcccgagggcatcatcgtcgag
agcgagagcctccatgccggcgacccgatgccgcgcccctatgtgctcaagcccgtcaac
gagggatcgtcggtcggcgtcgcgatcataaaagaacgtgacaatcacggcgtgccgatt
catcgtgactcgcatggcccgtggcagaccttcgcgaccctgctggcagaacccttcatc
cgggggcgcgagctgaccgtcgcggtgctcggcaatcgcgccctgggcgtgaccgagctg
gtccccagcagcggcttctatgactatgaagccaaatataccgacgggctgaccacccat
atctgccccgccgacgtccccgccgacatcgccgaggcggcgatgcggatggcgctcgac
gcgcaccggctgctcggctgcaagggcacgtcgcgctccgacttccgctgggacgacgaa
cggggcgaggccgggctctacctgctcgaggtcaacacccagccgggcatgaccccgctg
agcctggtccccgaacaggcgcgccatgtcggcttgacctatgccgacctggtccaggcg
atcgtcgacgaggcgctggccgggaaggccgcgcgatga

DBGET integrated database retrieval system