KEGG   Sphingomonas wittichii: Swit_4167Help
Entry
Swit_4167         CDS       T00538                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
swi  Sphingomonas wittichii
Pathway
swi00250  Alanine, aspartate and glutamate metabolism
swi00280  Valine, leucine and isoleucine degradation
swi00410  beta-Alanine metabolism
swi00640  Propanoate metabolism
swi00650  Butanoate metabolism
swi01100  Metabolic pathways
swi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:swi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Swit_4167
   00650 Butanoate metabolism
    Swit_4167
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Swit_4167
   00280 Valine, leucine and isoleucine degradation
    Swit_4167
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Swit_4167
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:swi01007]
    Swit_4167
Enzymes [BR:swi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Swit_4167
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Swit_4167
Amino acid related enzymes [BR:swi01007]
 Aminotransferase (transaminase)
  Class III
   Swit_4167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABQ70507
UniProt: A5VDZ1
LinkDB All DBs
Position
complement(4583186..4584490)
Genome map
AA seq 434 aa AA seqDB search
MSKPLTSSNDALWGRRLAAVPQGVATAAPIFAARAENAEIWDVEGRRYIDFASGIAVLNV
GHRHPRIIAAVEEQLGRFTHTAFQVVGYEPYVRLAERLNALAPVVGPAKTIFFTTGAEAT
ENAVKIARYASGRSAVIAFVNGFHGRTLLASAMTGKVLPYKKGFGPLPGDIYHIPFPSEA
HGITVEHSLAALANVLSSDVEAANVAAIILEPVQGEGGFHVAPFEFLRALRSLCDEHGIA
LIADEVQTGIGRTGKLFAVEHAGVRPDLITVAKSLGGGFPLSAVVGNAALIDRVPPGGLG
GTYAGSPIACAAGLAVLDVIEQDRLCDRAERMGRRITERLSAVAARRELPIGLPRGLGAM
IAFDIRAGLDDLRPDGAAAKRVCVRALELGLILLTCGQHGEAIRLLAPLTASDAVLDEGL
DILAQALADTLGTA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcccttgacctcatcgaatgacgccctctggggccggcggttggcggcggtg
ccgcagggcgtcgccaccgccgcaccgatcttcgccgcgcgagcggagaatgcggaaatc
tgggacgtcgaagggcggcgttacatcgatttcgcgtccggcatcgcggtgctcaacgtc
ggccatcgccatccgcggatcatcgccgcggtggaggaacagctcggccgcttcacccac
accgccttccaggtcgtcggctacgagccctatgtccggctggccgagcggctgaatgcg
ttggcgccggtcgtcggccccgcgaagacgatcttcttcaccaccggcgccgaggcgacc
gagaatgcggtgaagatcgcgcgctatgccagcggccgcagcgcggtgatcgccttcgtc
aacggcttccacgggcgcaccttgctcgcgtcggcgatgaccgggaaggtcctgccctac
aagaagggcttcggccccctgcccggcgatatctaccacatcccctttcccagcgaggcg
cacggtatcacggtcgagcatagcctcgctgcgctcgccaacgtgctcagctcggatgtc
gaggcggccaatgtcgccgcgatcatcctcgagcccgtacagggcgaaggcggcttccat
gtcgcgccgttcgaattcctgcgcgcgctgcgcagcctgtgcgacgagcatggcatcgcc
ctgatcgccgacgaggtgcagaccggcatcggccgcaccggcaagctgttcgcggtcgaa
catgccggggtccggcccgacctgatcaccgtcgccaagtcgctcggcggcggcttcccg
ctgtcggccgtggtcggcaatgccgcgctgatcgaccgggtgccgcccggcggcctgggc
ggcacctatgccggctcgccgatcgcctgcgccgccgggctcgccgtgctcgacgtgatc
gagcaggaccggctgtgcgaccgcgccgagcggatgggacggcggatcaccgagcggttg
agcgccgtcgccgcccgccgcgagctgccgatcggcctgccgcgcggcctgggcgcgatg
atcgccttcgacatccgcgccgggttggatgaccttcgtcccgacggcgccgccgcgaaa
cgggtctgcgtccgtgcactggagctcggcttgatcctgctgacctgcggccagcatggc
gaggcgatccgcctgctggcaccgctgaccgcgtccgatgccgtgctcgacgaagggctc
gacatcctcgcgcaggcgctggccgacacgctgggcaccgcatga

DBGET integrated database retrieval system