KEGG   Syntrophomonas wolfei: Swol_1089Help
Entry
Swol_1089         CDS       T00396                                 

Definition
(GenBank) threonyl-tRNA synthetase / Ser-tRNA(Thr) hydrolase
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:swo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Swol_1089
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:swo01007]
    Swol_1089
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:swo03016]
    Swol_1089
Enzymes [BR:swo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     Swol_1089
Amino acid related enzymes [BR:swo01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Swol_1089
Transfer RNA biogenesis [BR:swo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Swol_1089
 Prokaryotic type
    Swol_1089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon tRNA_SAD TGS MgtE_N
Motif
Other DBs
NCBI-ProteinID: ABI68399
UniProt: Q0AY05
LinkDB All DBs
Position
1253943..1255850
Genome map
AA seq 635 aa AA seqDB search
MISIRLKDGSQREYPEGISLLQVAEDISPKLAKNAMAAVFNGKISDLNSQVKEDGCLELL
DFEDERAREVYRHSSAHVMAQAVKRLWPESKLAIGPAIDKGFYYDFDSGHTFTPEDFAAI
EEEMKRIIKADYPIVRKELSREEALQFFSERSEDYKLELIEDLPEDAVISTYQQGEFVDL
CAGPHLPSTGRLKAIKVMSLAGAYWRGSERNPMLQRVYATSFPKKSMLDDYLQKLEEAKK
RDHRRLGRELGLFVVLDEGPGFPFFLPKGMVLRNELENFWREEHRKAGYQEIRTPIILSR
ELWERSGHWDHYKDNMYFTTIDEGDYAIKPMNCPGGLLVYKQNLHSYKELPLRMGEMGLV
HRHEMSGVLHGLMRVRAFTQDDAHIFMLPEQIIDEIKGVMDLVDRFYSLFGFPYHVELST
KPEKAMGSDEIWEVATNALIKALEERGMEYKVNEGDGAFYGPKIDFHLQDSLDRTWQCGT
IQLDFQMPEKFDLTYVGEDGGKHRPVMIHRVIYGSIERFIGILTEHFGGAFPLWLAPVQV
RVLPITQRSQDYARQVVAELEQAGIRVEADFRSEKIGYKIREGQLQKIPYLLVLGDREAE
EGTVSVRHRKEGDLGAKLLEEFKQTIVKEIKDKVL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgatatccatcagattgaaagacgggagccagcgggaatacccggaaggcataagtctt
ttgcaggttgcggaagatatcagccctaaactggccaaaaatgcaatggcggcggttttt
aacggcaagatatctgatttgaatagtcaggtcaaggaagacggttgcctggaactgctt
gatttcgaagatgaaagagcccgtgaggtttaccggcattcttccgctcatgtcatggcc
caggcggtaaaaagattgtggccggagagcaagctggctattgggccggctattgacaag
ggattctattatgattttgacagcggacacacctttactccagaggattttgccgccatt
gaagaagaaatgaaacggattatcaaagccgattatcccatagttagaaaagaactgtca
cgggaagaagccctgcagttttttagcgagcgcagcgaggattacaagctggaactgatt
gaagaccttccggaagatgctgtaatcagcacttaccagcaaggtgagtttgttgacctc
tgtgctggtccgcatctgccttcaactggtcgtttgaaagccataaaggtcatgagcctg
gcgggggcttattggcggggaagtgagagaaaccccatgttacagagggtttatgctact
tcctttcctaaaaagtctatgctcgatgattacctgcaaaaattggaggaagcgaaaaaa
cgcgatcaccggcgcctgggaagggaactgggcctgtttgtggttctggacgaaggtcca
ggctttccctttttcctgcccaaagggatggttttgcgtaatgaactggagaatttttgg
agagaggaacaccgaaaagccggttaccaggagatacgcaccccgataattcttagccgg
gagctgtgggagagatcaggacactgggatcactataaggataatatgtattttaccacc
attgacgagggcgattacgccataaaaccgatgaattgcccgggaggcctgctggtatat
aagcaaaacctgcacagctacaaggaactccctttgcggatgggggaaatggggctggta
caccggcatgaaatgtccggtgtcttgcatggactgatgagggtgcgggccttcacccag
gatgatgcccatatattcatgttaccggaacagattatcgatgagatcaagggtgtaatg
gatctggtggatcgtttctatagtctctttggttttccctaccatgtagagctttccacc
aaaccagagaaagctatgggctctgacgaaatttgggaagtagctaccaatgccttgatt
aaagccctggaggaaaggggtatggagtacaaggttaatgaaggggatggagctttttac
ggacccaagattgatttccatctccaggattcgctggatcgcacctggcagtgtggcacc
atacaactggattttcagatgccggagaaattcgatcttacttatgtgggtgaggatggg
gggaaacaccgcccggtaatgattcaccgggttatatatggcagcattgaacgcttcatt
ggcattttaactgaacatttcggcggtgcctttccgttgtggctggcaccggttcaggtc
cgggtgcttcctattacccagagaagccaggattatgctcgccaggtagttgcggaactg
gagcaggcaggcataagggtagaggctgatttccgcagtgaaaaaattggctacaagata
agggaagggcaactgcagaagataccctatctcctggttctgggcgaccgggaggcggaa
gagggcacggtttcggttcgtcatcgtaaagagggggatctgggtgccaaacttttggag
gaatttaaacaaacaattgtgaaagaaattaaggataaagttctttag

DBGET integrated database retrieval system