KEGG   Syntrophomonas wolfei: Swol_1124Help
Entry
Swol_1124         CDS       T00396                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
swo  Syntrophomonas wolfei
Pathway
swo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:swo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Swol_1124
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:swo03400]
    Swol_1124
Enzymes [BR:swo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Swol_1124
DNA repair and recombination proteins [BR:swo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Swol_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACC_central
Motif
Other DBs
NCBI-ProteinID: ABI68434
UniProt: Q0AXX0
LinkDB All DBs
Position
1300132..1301043
Genome map
AA seq 303 aa AA seqDB search
MGESATIAMAGREIKLTNLDRVLWPEDGYCKRDLVEYYTAIFPYMLPHLSERPLVFTRYP
RGIGEKSFYQKNAPEGLPQWIKTFTWAGSDGDSKNYVLVQQTVDLMWLANLACIEIHPWL
SQINSIEYPDFIVFDLDPSEQSTFEQVISVARLLHELMDSLSLRVYPKTSGAKGLHLYLP
IAEGFTYSQIRRVAQAMAEMVCQVIPDIATTERALKHRGPRVYLDYLQNGLGKTVCAAYS
VRPHKGAPCSTPIEWQELESIRPDQFTIKTLPERLQQVGDLFADVLNDRQDLKKAMATLG
VSR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaatcagcaacgatagctatggcgggaagagagattaagcttactaatctggac
cgggttctttggccggaagacggctattgcaaaagagatttagtggaatactatactgcg
atttttccctatatgcttcctcatctaagcgagcgtccgctggtcttcacccgctatccg
cggggaattggagaaaaatcattttatcaaaaaaacgccccggaaggccttccgcagtgg
ataaaaacttttacctgggctggcagtgatggcgatagcaaaaactatgtcctggtgcag
caaacggtagatcttatgtggctggccaatctcgcctgcattgaaattcatccctggtta
tcgcaaatcaatagtattgaatatcccgattttatagtatttgacctggacccttcagag
cagagtacctttgagcaagttattagcgtggcccgcctgctgcatgaattaatggatagt
ctaagtctccgggtgtatcccaaaacttcaggggcaaaagggcttcacctttacctcccc
atagccgagggttttacctatagtcaaatacgccgtgtggcccaggcgatggcggagatg
gtttgccaggtgatccctgatatagctaccaccgaaagagctctaaaacatcgggggcct
cgggtttacctggattacctgcaaaacggcctgggtaaaactgtctgcgctgcttacagc
gttcgtcctcataagggggccccctgttccacccctattgagtggcaggaacttgagtcc
ataagaccggatcaatttacgattaaaaccttaccggagcgacttcagcaggtaggagat
ttattcgctgatgttctaaacgaccgccaggatctaaaaaaagccatggcaacattgggg
gtttccaggtaa

DBGET integrated database retrieval system