KEGG   Syntrophomonas wolfei: Swol_1155Help
Entry
Swol_1155         CDS       T00396                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00473  D-Alanine metabolism
swo00550  Peptidoglycan biosynthesis
swo01100  Metabolic pathways
swo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:swo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Swol_1155
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Swol_1155
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Swol_1155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:swo01011]
    Swol_1155
Enzymes [BR:swo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Swol_1155
Peptidoglycan biosynthesis and degradation proteins [BR:swo01011]
 Precursor biosynthesis
  Amino acid ligase
   Swol_1155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST ATP-grasp ATP-grasp_4 RimK GARS_A ATPgrasp_Ter ATPgrasp_YheCD B12-binding TTL Glyco_tran_WecB
Motif
Other DBs
NCBI-ProteinID: ABI68465
UniProt: Q0AXT9
LinkDB All DBs
Position
1338214..1339143
Genome map
AA seq 309 aa AA seqDB search
MNKVLVLMGGTSEEREVSLKSGKAVYEGLKDAGYEVEALDFTPETIHRIREYSPDVVFIT
LHGKNGEDGTVQGYLELLGIPYTGSGVLASAVCMNKVITKKLLSYEGLPTADFQVIKKRG
FNRDLFNPDLLMEDFGLPLVVKPATQGSSVGTSIVRKRKNIVPALELALSLDEEILVEKF
IAGTELTVTVLGKDNLKTLPVIEIVPKNEYYDYESKYMPGMSDHLIPARISEEERERVEE
ISCKAYDAVGCRGYGRIDLILDRGGNPYILEINTLPGMTGTSLVPDAARAAGIKFPELLD
LFVKMALEK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgaataaagtactggtactgatggggggaacttctgaggaacgggaggtttccttaaaa
agtggcaaggctgtttatgaggggctaaaagatgcaggatatgaagtggaagctttagat
tttacgccggagactatacatcggataagggaatattcacctgatgtggtttttataacc
ctgcacggtaagaacggggaagatggtaccgttcaaggttatcttgaacttctgggaata
ccttacaccggatcaggagttttagccagtgctgtttgtatgaataaagttataaccaag
aagctattgagctatgaaggcttgcccacggctgattttcaagttatcaaaaagagaggg
tttaatagagatttatttaatccagatttgttaatggaagactttggcttgcccctggtg
gttaaaccggctacccagggctcaagtgtgggtacatcaattgttagaaaaagaaaaaat
attgtgccggcccttgaactggctttatcattggatgaagaaatactggtggagaaattt
attgctggaaccgaacttactgtaacggttttgggtaaggataatcttaaaacgttacca
gtaattgagatagtaccgaagaatgaatactatgattatgaatccaagtatatgccggga
atgtccgatcatttaatacccgccagaatcagtgaagaggaaagagaaagagtagaggaa
attagctgtaaagcctatgatgcagtgggatgccggggttatggcagaatcgatttaata
cttgaccggggaggtaatccttatatattggaaataaatacacttccagggatgaccggg
accagcttggttcctgatgcggccagagcagcaggtatcaagtttccagaattactcgat
ctttttgttaagatggccctggagaaataa

DBGET integrated database retrieval system