KEGG   Syntrophomonas wolfei: Swol_1225Help
Entry
Swol_1225         CDS       T00396                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
swo  Syntrophomonas wolfei
Brite
KEGG Orthology (KO) [BR:swo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:swo01001]
    Swol_1225
Enzymes [BR:swo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Swol_1225
Protein kinases [BR:swo01001]
 Serine/threonine kinases: Other
  Bacterial family
   Swol_1225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo RIO1 Kinase-like Pkinase_fungal Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: ABI68534
UniProt: Q0AXM0
LinkDB All DBs
Position
complement(1415669..1417507)
Genome map
AA seq 612 aa AA seqDB search
MKTTVLGDRYELMDKIGEGGMASVYRARCRTLDRIVAVKILKEELLNDKSFVEKFNTEAL
SAAQLSHPNIVNVFDVGQQDQLYYIVMEYVEGKSLKELLDTEAPLTVEMAVDIAIGICDG
IHHAHSKGIIHRDIKPHNILITSDGIVKVADFGIAQAISQKTITFGGNIVGSVHYISPEQ
AKGEAVGPASDIYSLGCVLYEMLTARLPFDADSPITVALKHMYDEPASPRNINPKIPPAL
EGIIMKAMEKLPAERFTSAEAMRNALLDLEGNSLAGYKRSNRNGKTLILPPWKEQEMDGV
LKKKKIRTPFLVGIIIAVLGLLGGFLSTMGGQLFPDEVAVPNIVGMDIKEAERELSKVNL
SMSVIQEFNDEYDKNIIFFQNPGPEQKVKEGREIKVKMSKGSELQKTPSLRGLKLIDAEI
KLRNEGLELGRTEKIYDDKYEADIVISQNPEAGSRIKKGSKVDLMVSKGKTPEKVAMPKL
LGLSLKEASNKLQENKLLPGEVKYQPSSEYYSDQVCSQEIETGVLVDENSSIALTVSQGP
GPLAKVKDIEFSLPLEQDYYKVLISIKDSQGKRQVYEELHRAGDTVYAAVRYYGSGELEI
LLNGKSYKTMKL
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaccacggttttaggtgatcgttatgaattaatggataaaatcggcgaaggggga
atggcctcagtttatcgagcccgctgccgtaccctggaccgtatagtagcagtcaagatt
cttaaagaagagcttttgaatgataagagttttgtggagaaattcaataccgaggcttta
tctgcagcccagctatcccaccccaatattgtcaatgtttttgatgtaggccagcaggat
caactatattatattgtaatggagtatgttgaaggtaaaagcctgaaggaattgcttgat
acagaggctccactaacggtagaaatggcggttgatattgctatagggatatgtgatggc
attcatcatgcccacagtaaaggtattattcaccgggatattaagccgcataatatctta
atcacctctgatggaattgttaaagtagctgatttcgggatagcccaggctatttcccag
aagaccattacctttggcggtaacattgtgggttcggtacattatatttctcccgagcag
gccaagggtgaagcggtcggcccggccagtgatatatattccctgggttgtgtactatat
gagatgcttactgcccggctaccctttgatgccgatagccccattaccgtagctttaaaa
catatgtatgacgaaccggcgagccccagaaacattaacccgaaaattcctccggctcta
gagggcataataatgaaagccatggagaaactgcccgcagagcgctttaccagtgctgaa
gccatgcgcaatgccctgctggatctggagggtaattccctggctggctacaaaagatct
aatagaaatgggaaaaccctgatattacctccctggaaggaacaggagatggatggcgtc
ttgaaaaagaaaaagattcgcaccccgtttttagtgggaataattattgctgttttaggt
ttgttaggtggttttttaagtactatgggtggccagttgtttccggatgaggtagcggtt
ccgaatattgtgggaatggatattaaagaggcggagcgtgagctaagtaaagtaaattta
agcatgagcgtaatccaagaatttaatgatgaatacgataagaatataatctttttccaa
aatcccggccctgagcaaaaggttaaagaggggcgggaaataaaagttaagatgagtaag
ggctcagagctgcagaagacaccctctctgagagggttaaagcttattgatgctgaaatc
aagttgaggaatgagggcttggaactagggagaacagaaaagatttatgatgataaatac
gaagcagatatagtgatatcacagaatccagaagcagggagtcgaattaaaaaaggcagc
aaggttgatcttatggtcagcaaaggaaagaccccggaaaaggtagctatgcctaaactg
ctgggcctgagcctcaaggaagccagtaataaactgcaggaaaacaaactcttgcctggt
gaggtaaaatatcaaccaagcagtgaatactattctgatcaggtttgcagccaggaaatt
gaaactggtgttctggtggatgagaacagcagcatagctttaactgtcagccagggacca
gggccgctggccaaggtcaaagatattgagttttctcttcccctggagcaggattattat
aaagtgctcattagcattaaggatagtcaggggaagcggcaggtttatgaagaattgcac
cgggccggtgatacggtatatgcagcggtgagatactatggaagcggagagctggaaatt
cttttaaatggtaaatcctataaaaccatgaagctttag

DBGET integrated database retrieval system