KEGG   Syntrophomonas wolfei: Swol_1703Help
Entry
Swol_1703         CDS       T00396                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00030  Pentose phosphate pathway
swo01100  Metabolic pathways
swo01120  Microbial metabolism in diverse environments
swo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:swo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Swol_1703
Enzymes [BR:swo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Swol_1703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N HEPN_SAV2148 Molybdopterin
Motif
Other DBs
NCBI-ProteinID: ABI69001
UniProt: Q0AWA3
LinkDB All DBs
Position
complement(1936545..1938338)
Genome map
AA seq 597 aa AA seqDB search
MYAWIGQILRVNLTDATIKKEKLDPALLRNYIGARGLGSKLFMDEVNPQVDPLSPENKII
FMTGPLTGTLAASGGRYNVVTRGPLNGTIAASNSGGSFGPELKYAGYDGIIFEGKAEKPV
YLWINNAEVELRSAEELWGRNVPETTDMIKQATHEEAKVACIGPAGEKLVKFACIMNEYN
RAAGRSGVGAVMGSKNLKALAVRGTGGIKVADRQGFMQAITDARNKLKAHPVTGAGLAAY
GTNVLVNILNEHGGLPVKNFSEAAVFAKAENVSGEYQAEHCLVRNKGCFGCSIGCGRVSR
NRGKYKGIGEGPEYEATWGLGPNLYIDDFEAISKANFLCNELGLDPISLAGTLACATEMM
EKGFIPQEKAELCWGDADMLVEMTIKTAYREGFGDELAEGSYRLAEKYGHPEFSMSVKKQ
ELPAYDPRGQQGIGLNYATSNRGGCHVRGYMTSPEVLGIPEKVDPDSTEGKAALLKIFQD
LTALVDSAGICLFTTFGQGLPEIAEQLRQATGLDLSDEEFLLAGERIWNLERSFNLQAGI
SSKDDTLPPRLLREPMKGGPHQGNVVRLELMLPEYYTLRGWDQAGVPTPEKLQELSL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcatggataggacagattttaagggttaacctcactgacgctactataaaaaaa
gaaaagcttgatccagcgcttctacgaaattatatcggagcccggggcctgggaagcaaa
ttgttcatggatgaagtgaatcctcaggtggatcccttgagcccggaaaacaagattatt
tttatgaccggccctcttaccggaactctggctgcctcgggcggacgctataatgtagta
acccggggaccgctaaatggtaccattgctgcttccaactcaggggggagttttggtccg
gagcttaaatatgccggttatgatggaatcatttttgaaggaaaagctgaaaaaccggtt
tatctatggataaataatgctgaagtggaattaagaagtgcagaagagctctggggacgc
aatgttccggaaacgactgatatgattaagcaggctacgcatgaggaggccaaagtcgcc
tgtataggaccggctggagaaaaactggtcaagttcgcctgcataatgaatgagtataac
cgggccgcggggcgctccggagtgggagcggtcatgggctcaaagaacttgaaagccctg
gcagttcgaggtaccggaggtatcaaagtggctgaccggcagggtttcatgcaggcaatt
accgatgcccggaacaaattgaaagcgcatcccgtaaccggggccggtttggcggcttat
ggcaccaatgttttggtaaatattctgaatgagcacgggggcttgccggttaagaacttc
agtgaagcagcggtttttgcaaaggcggaaaatgtttccggcgagtaccaggccgaacac
tgcctggtgcgcaacaagggttgctttggttgttccatcggttgtggccgggttagccgc
aaccggggcaaatataaaggtattggcgaagggccggagtacgaggcaacctggggtttg
ggacccaatctttatatcgatgattttgaagccatttccaaggccaactttctttgcaac
gagttgggtcttgatcccatctccctggccggcaccctggcctgtgctacggaaatgatg
gaaaagggtttcattcctcaggaaaaggcggagctgtgctggggtgatgccgatatgctg
gtagaaatgaccatcaagaccgcctaccgggagggattcggggatgaactggcggaaggt
tcttatcgcctggctgaaaaatacggtcatcctgaattttccatgtcggtgaagaagcag
gaactgcccgcttatgacccccgggggcaacagggaatcggtttgaactatgctacctcc
aaccggggcggttgccatgtcaggggctacatgacttcccctgaggttctgggtataccg
gaaaaagtggatccagacagcaccgaaggtaaggcagccctgcttaaaatattccaggat
ctcactgctctggtggattcggccgggatttgtcttttcactacctttggccagggtttg
ccggagatagcggagcagttgcgccaggccaccgggcttgatttaagtgacgaggaattc
ctgctggcgggggaacggatctggaatctggaacgctcctttaacctgcaagccggtatc
agcagcaaagatgacacccttcctccccgtctcctgcgtgaacccatgaaaggtggtcct
caccaggggaatgtggtcaggttagagcttatgttacctgagtactataccttgcgggga
tgggaccaggccggtgttcccactccggagaaactacaggaactcagcttgtaa

DBGET integrated database retrieval system