KEGG   Syntrophomonas wolfei: Swol_1711Help
Entry
Swol_1711         CDS       T00396                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
swo  Syntrophomonas wolfei
Brite
Enzymes [BR:swo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Swol_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABI69009
UniProt: Q0AW95
LinkDB All DBs
Position
1946085..1946684
Genome map
AA seq 199 aa AA seqDB search
MAHTLPDLPYAYDALEPFYDEQTVRLHHDMHHKAYVDGLNNAESKLAEALEKGDFALIKH
IERELSFHGSGHILHTMFWENMKPGGGGPADGAVAELIDRDFGSFDNFKKLFSASALAVE
GSGWTILACNPIFEKLVVLQAEKHQDLTQWGAVPLLIVDVWEHAYYLKYQNKRAAWIEAW
WNLINWDDVNRRVALMQQK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctcatactctaccggatttaccgtatgcctatgatgcgctggaacctttttacgat
gaacagacggtgagattacaccatgatatgcaccacaaggcctatgttgatggactaaac
aacgcggagagcaagctggccgaagccctggaaaaaggtgatttcgccttaatcaaacac
atcgagcgggagctgtctttccacggctcaggacacattttgcacactatgttttgggaa
aatatgaagccgggcgggggaggtcctgccgatggggctgtggctgagctgattgaccgt
gatttcggctccttcgataacttcaaaaaactcttctctgcttctgcccttgcggtagag
ggttcgggatggaccatactggcctgcaatccgatatttgaaaagctggtggtcttgcag
gcagaaaagcatcaggatctaacccaatggggcgcagttccgttgttgattgtggatgtc
tgggaacatgcttattacctcaagtaccagaacaagcgggcggcctggattgaagcctgg
tggaatctcataaactgggatgatgttaaccggcgggtagctttaatgcagcaaaaataa

DBGET integrated database retrieval system