KEGG   Syntrophomonas wolfei: Swol_1727Help
Entry
Swol_1727         CDS       T00396                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K18369  alcohol dehydrogenase [EC:1.1.1.-]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00640  Propanoate metabolism
swo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Swol_1727
Enzymes [BR:swo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Swol_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABI69025
UniProt: Q0AW79
LinkDB All DBs
Position
1968979..1970037
Genome map
AA seq 352 aa AA seqDB search
MADTMKALVYRGPEKIGLEDVPMPKIIEPDDAIVKVTTSTICGTDIHIWHGGMPEVEPGR
IIGHEFVGEVVEVGPAVRNNKVGDKVAVSCVTQCGECFYCVRGVYSHCTTGSWIFGYMID
GCQAEYVRVPHANLGMFTIPDGLTEEDVLFVGDILSTGYFGSEQGRIEPGDTVAVMGGGP
VGMCAMTTARLWGPAEIIAVDINQERLDFAVKNGIADVGINPQKVGNVGDAIRERTGGRG
ADVTIEANGFKPTFDMAVDSVRPGGTISLIGVFEKPQELAMNTLWIKNIRISMGLVNANR
IPELIKLIQRGKIDTNYLITHRAPLNDILKGYDVFGGKKDGCLKWVVTPYVK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcagataccatgaaagcattggtttaccgtggacccgaaaagataggcctggaagat
gttcctatgcccaagattattgaacccgatgatgccattgtcaaggtaacgacttccacc
atatgtggaaccgatattcatatctggcatggcggaatgccagaagtcgaaccaggcaga
ataatcggtcacgaatttgttggagaagttgtggaagttggtccggcagtccggaacaac
aaagttggagacaaggttgccgtttcctgtgtaactcaatgcggcgaatgcttttattgt
gtaaggggagtatattcccattgcaccaccggcagctggatatttggttatatgatagac
ggatgtcaagccgaatatgtaagagtccctcatgccaacctgggaatgttcaccattccg
gatgggctcactgaagaagatgtgctattcgtaggagacattttgtctactggatacttt
ggttctgagcaaggccgcatagagcccggtgatacggttgcggttatgggcggcggaccg
gtcggaatgtgtgcaatgactaccgccagactatgggggcctgccgaaattattgctgtt
gatatcaaccaggaacgtctggatttcgctgtgaagaatggtattgccgatgtaggaatc
aatccccagaaggtcggtaatgttggcgatgccattagagaacggaccggcgggcgtgga
gccgatgtcaccattgaagctaatggatttaaacccacctttgatatggcagtagacagc
gtcagaccaggcggcactatttccctgatcggagttttcgaaaaacctcaggaactggct
atgaataccttgtggattaagaatattcgcataagcatggggttggtaaacgccaaccgg
attccagaattaatcaaattgattcaaagagggaaaattgacaccaattacttgattacc
catcgtgcccccttaaatgacatccttaaaggatacgatgtctttggtggcaagaaagac
ggttgcctcaagtgggttgttaccccttatgtaaaatag

DBGET integrated database retrieval system