KEGG   Syntrophomonas wolfei: Swol_2290Help
Entry
Swol_2290         CDS       T00396                                 

Definition
(GenBank) N-acetylglutamate synthase / glutamate N-acetyltransferase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00220  Arginine biosynthesis
swo01100  Metabolic pathways
swo01110  Biosynthesis of secondary metabolites
swo01130  Biosynthesis of antibiotics
swo01210  2-Oxocarboxylic acid metabolism
swo01230  Biosynthesis of amino acids
Module
swo_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:swo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Swol_2290
Enzymes [BR:swo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     Swol_2290
    2.3.1.35  glutamate N-acetyltransferase
     Swol_2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: ABI69581
UniProt: Q0AUM3
LinkDB All DBs
Position
complement(2636600..2637805)
Genome map
AA seq 401 aa AA seqDB search
MKIINGSVCAPRGFLAQGVEAGIKKIDKKEVAIIYSTEPCTAAGVFTSNKVRAACIDYNK
ACLADSTARAIVANSGNANACTGEQGIKDSQRMADLTGELLGIEGSDVLVGSTGVIGVFM
PMEKVEKGIRKAAAALSRDGEHNAAQAIMTTDLTSKELAIEIEIKGKPVRIGGIAKGSGM
IHPNMATMLAFITTDAAIDSKCLQKMVKAAADRSFNMISVDRDTSTNDMLVVLANALAGN
PLIDVEGSEDYLLLQEALDFLCISLAKMIARDGEGATRLIEVQVVNAADYEEARQIARSI
TASNLTKAAVFGEDANWGRILAAAGYSGADFDPGRVDIYLGQEKMAENGMGLIFNEERAR
QELKQDPVLIKVDLKSGKEQATAWGCDLSYDYVRINAAYRT
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagattataaacggttctgtctgtgcccccaggggttttttagcccagggggtagaa
gcgggaataaagaagatagataaaaaagaagtcgccattatatattccactgagccctgt
actgctgccggagtttttaccagcaataaagtcagagctgcctgtattgactacaataag
gcttgtttggctgatagcaccgcccgggctatagtggctaacagcggcaatgccaatgcc
tgcaccggggagcaaggcattaaggatagccagcggatggccgatttgaccggggaactg
ctggggattgagggcagtgatgtattggtcggctccaccggggtcattggggtttttatg
cccatggaaaaggtggaaaaagggatcaggaaagccgctgcagccctttcccgcgatggt
gagcataatgcggctcaggccataatgactaccgatttgaccagcaaggagctggccata
gaaatagaaataaagggaaagccggttagaataggcgggattgctaaaggttcaggcatg
atacaccccaatatggcaacaatgctggcctttatcacaacagatgctgccatagacagc
aaatgtttacagaaaatggtaaaggccgcagccgaccgctctttcaacatgatcagcgtg
gaccgggatacttctaccaatgatatgctggtagttttggccaacgctttggcggggaat
cctcttattgatgtagagggctcggaagattacctgctcctgcaggaagcactggatttt
ttatgtatcagcctggccaaaatgattgcccgggatggggaaggtgctacccgtttaatt
gaagtgcaggtggttaatgccgcggattatgaagaggcccggcagattgcacgctccatc
actgcttccaacttgaccaaagcggccgttttcggcgaggacgccaactggggaaggata
ctggcggcggcaggctattccggagcagatttcgaccccgggcgggtggatatatacctg
ggtcaggagaaaatggcggagaacggtatgggcttgatctttaatgaggagcgggcacgc
caggagcttaaacaggacccggtgctgattaaagtagatttaaagtcggggaaagagcag
gctaccgcctggggctgtgacctttcttacgattatgttcgtataaatgcggcttaccgg
acttga

DBGET integrated database retrieval system