KEGG   Shewanella piezotolerans: swp_2754Help
Entry
swp_2754          CDS       T00791                                 

Definition
(GenBank) Superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
swp  Shewanella piezotolerans
Brite
Enzymes [BR:swp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     swp_2754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACJ29482
UniProt: B8CMU2
LinkDB All DBs
Position
2883506..2884090
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISEETINYHYGKHHNTYVVKLNGLVEGTELAEKSLEEIIKTS
TGGIFNNAAQIWNHTFYWNCLSPNGGGEATGPVADAIVAAFGSFDAFKAQFTDSAVNNFG
SAWTWLVKKADGTVAIVNTSNAATPLTDESVTPVMTVDVWEHAYYIDYRNVRPDYMAHFW
ELINWDFVNANFAG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattaccagcattaccttacgcaaaaaacgcacttgagccacatatctca
gaagaaaccatcaactaccattacggcaagcatcacaacacatacgttgttaagctaaac
ggcttagttgaaggtactgaacttgcagagaagagcctagaagagatcatcaagacctct
actggtggtatcttcaacaacgcagctcaaatctggaaccacactttttactggaactgt
ctatcaccaaacggtggtggtgaagcaacaggcccggtagctgacgctatcgttgctgca
ttcggttcattcgatgcatttaaagcacagttcactgactcagcagttaacaacttcggt
agtgcttggacttggttagtgaaaaaagcagacggtactgttgctatcgttaacactagc
aacgcagctacaccacttactgatgagtctgttaccccagtcatgactgtagatgtttgg
gaacatgcatactacattgattaccgtaatgttcgtcctgactacatggctcacttctgg
gagctaatcaactgggattttgttaacgcaaacttcgcgggttaa

DBGET integrated database retrieval system