KEGG   Shewanella piezotolerans: swp_3293Help
Entry
swp_3293          CDS       T00791                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
swp  Shewanella piezotolerans
Pathway
swp00250  Alanine, aspartate and glutamate metabolism
swp00410  beta-Alanine metabolism
swp00430  Taurine and hypotaurine metabolism
swp00650  Butanoate metabolism
swp01100  Metabolic pathways
swp01110  Biosynthesis of secondary metabolites
swp01120  Microbial metabolism in diverse environments
swp02024  Quorum sensing
Module
swp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:swp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    swp_3293
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    swp_3293
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    swp_3293
   00430 Taurine and hypotaurine metabolism
    swp_3293
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    swp_3293
Enzymes [BR:swp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     swp_3293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-ProteinID: ACJ29997
UniProt: B8CRI9
LinkDB All DBs
Position
3473757..3475403
Genome map
AA seq 548 aa AA seqDB search
MTPRRATASEEALLRIFTVPEAPDSTLSVIEQNISQNLMGFLQESVVAVEKPLTEIELDF
QQHQIPAAPQFVSDYADDMMQTLVAHSVHTSAPSFIGHMTSALPYFVLPLSKMMVGLNQN
LVKIETSKAFTPLERQVLGMMHHLIYAENDDFYQNWMHSANVSLGAFCSGGTVANITALW
TARNQLLKADGNYRGVAAQGVMKGLRHYGYDDLAILVSERGHYSLGKTADLLGIGRENII
QVPTAEDNKVDVSKMRKLANQLAADKIKVMAIVGVAGTTETGNIDPLNELADLASELNCH
FHVDAAWGGASLLSEKYRHLLAGIERADSVTIDAHKQMYVPMGAGMVIFKDPTFANAIKH
HAEYILRKGSKDLGSQTLEGSRPGMAMLVHACLKVIGRDGYEILINNSLEKARYFADLIN
QHQDFELVSKPELCLLTYRYVPQKVQIAMANARANNDVDKLSEFNSLLDGLTKFVQKRQR
EQGTSFVSRTRINPEKAHLMDIKAVVFRVVLANPLTTPEILQQVLAEQKVIASQEQRFLP
NLLALAER
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgacaccaagacgagccaccgcttctgaagaggcactactgagaatttttaccgttcca
gaagccccagattcaacccttagtgttattgagcaaaatatctcacagaacttaatgggc
tttttgcaagaaagtgtagtcgcggttgagaaacctctcaccgagattgaactagacttc
cagcaacaccaaattccagccgcgccgcaatttgtctctgattacgccgacgacatgatg
caaacgcttgtcgcgcactcagtgcatacctctgcgccaagctttataggccacatgaca
tcagcgctgccctactttgtactgccgttatcaaaaatgatggtaggtttaaaccaaaat
ctggttaaaatagaaacgtctaaagcctttacgccattagagcgccaagtgttaggcatg
atgcatcacctcatttatgctgaaaatgatgacttctatcaaaactggatgcacagcgct
aacgtctctttaggcgcattttgctctggtggtactgtcgccaacattactgccctttgg
actgcccgtaaccaactgctaaaagctgatggcaattaccgcggcgtcgcagcgcaaggg
gtaatgaagggcctacgtcattatggttatgacgacttggccattttagtgtctgagcgt
ggccactactctttaggcaaaacagccgatctactcggcattggccgcgaaaatatcatc
caagtacccactgcagaagacaacaaagtcgacgtatcaaaaatgcgtaaacttgccaat
caactggccgcagacaagattaaagtgatggcgattgtgggcgttgcggggaccactgaa
acaggcaatattgaccctctcaatgagcttgctgatttggccagcgagcttaattgccat
tttcatgttgatgcagcatggggcggcgccagtctgttatctgaaaagtatcgtcacctg
cttgcaggcatagagcgcgcagactctgttaccattgatgctcacaaacagatgtatgtc
ccgatgggcgcgggcatggtgatctttaaagatcctactttcgctaatgcgattaagcac
cacgccgagtatattctcagaaaaggctcgaaagatttaggcagccaaactttagagggc
tcgcgccctggtatggcaatgctagtccatgcatgcttaaaggttatcggtcgtgatggc
tatgaaatactgatcaataacagtttggaaaaagcgcgttattttgctgatttgatcaac
caacatcaagattttgaactcgtgtcaaaaccagagctttgcctgttaacctaccgttat
gtgccgcaaaaagtgcaaatagcgatggccaatgcacgagcaaataatgacgtagataag
ctatcagaatttaattcactactggatggattaactaagtttgtgcaaaaacgtcagcga
gaacaaggcacttcttttgtttctcgcactaggattaatccagaaaaagcgcatttgatg
gacatcaaagcggtggtatttagagttgtattagccaatccgttaacgacgccagagatc
ttgcaacaagtgcttgcagagcaaaaggttatcgcttctcaagagcagcgttttttaccc
aaccttttagcgctcgcagagcgatag

DBGET integrated database retrieval system