KEGG   Shewanella piezotolerans: swp_4326Help
Entry
swp_4326          CDS       T00791                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
swp  Shewanella piezotolerans
Brite
KEGG Orthology (KO) [BR:swp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    swp_4326
Enzymes [BR:swp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     swp_4326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored Thi4 AlaDh_PNT_C NAD_binding_7 FAD_binding_3 Glutaredoxin DAO FMO-like NAD_binding_8 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ACJ30974
UniProt: B8CUB8
LinkDB All DBs
Position
complement(4528484..4530046)
Genome map
AA seq 520 aa AA seqDB search
MLDANVKNQLNTYLQNLKHPVELVVSADDSKKAQELKSLASDIDSLSSFISVTEKVGKRT
PSMAVINPQLASQITFAGLPMGHEFTSLVLALLHSGGHPIKLDADVIAQIRDLPGEYQFE
TYVSLSCQTCPEVVQALNMMAAINPNITNVMIDGSLFQDEVNERNVMAVPAVFLNGEQFS
MGAISTVEILNKLDVNAAGRKAEQLNEKEPFEVLVVGGGPAGASAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVHEYDVDIMDSQRALSLKSGELFELT
LESGAVLRSKTILLATGARWREMNVPGEQEYRGSGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDSTLRADDVLQRKARSMGNIEIITQAMTTEVTGDGKRVNG
LNYTNRATGESHHVELAGIFVQIGLVPNSEWLQETIDMTARGEIIVDAKGETSLPGVFAA
GDVTNSAYKQIIIAMGSGATASLGAFDYLIRHSVDEAVTA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacgtaaaaaatcaactgaatacttacctgcagaacctcaaacaccca
gttgagcttgttgtatctgccgatgacagtaaaaaagcccaagagcttaaatcacttgcc
agcgatatcgatagcttatcgtcatttatttctgtcacagaaaaagtcggtaaacgcaca
ccgtcaatggcggtgattaacccgcagcttgctagtcaaattacctttgcaggtttgcca
atggggcatgaatttacctccttggtattggctttactgcacagcggaggacacccaatc
aagcttgatgctgatgtgattgcacagatccgcgatcttcccggtgagtaccagtttgag
acgtatgtatcacttagctgtcaaacctgccccgaggttgtgcaagcgctgaatatgatg
gcggcaattaaccctaatatcaccaacgtgatgattgatggttctctgttccaagatgaa
gttaacgaacgcaacgtgatggcggttcctgcggtatttcttaacggcgagcagttctcc
atgggggcgattagcactgtagagatccttaacaaactcgatgtgaatgctgcaggcaga
aaagccgagcagctcaatgagaaagaaccgtttgaagtgttagtcgtaggtggtggccca
gcaggcgcatctgcagcgatttatgctgcacgcaaaggtttacgaaccggcattgttgcc
gacaaatttggtggccaagtggctgaaacggtaggtattgagaactttatctcagttaaa
gccacagaaggaccaaagctggtggccaatcttgaagcacacgtgcatgaatatgatgtt
gatattatggatagtcagcgcgccttgagcttaaagtcaggtgaactgtttgaactcacg
ctcgaaagcggcgcagtgctgcgcagtaaaaccatattgctagccactggtgctcgctgg
cgcgaaatgaacgtaccgggtgagcaagagtaccgcggtagtggtgttgcttattgccca
cattgtgatggcccattgtttaagggcaagcgtgtggccgtgattggtggcggcaactcg
ggtattgaagctgccattgatctggccaatattgtagagcacgttactgttcttgagttt
gatagcacactaagagcagatgacgttctgcagcgcaaagccagatcaatgggtaacatt
gaaatcattactcaggcgatgaccactgaagtgaccggtgacggcaaacgagttaacggg
ctgaattacactaatagagcgacaggcgagtcacaccacgttgaactggcgggtattttc
gtacagataggtttggtgccgaactctgaatggttgcaagagacaattgatatgacggct
agaggcgagatcattgtcgatgctaaaggtgaaacatcactgccaggcgtatttgccgca
ggtgatgtgaccaactccgcctataagcaaattattatcgctatgggcagcggcgctacc
gcttcactgggggcgtttgactatttgatccgccatagtgttgatgaagcggtcacagca
taa

DBGET integrated database retrieval system