KEGG   Streptomyces xiamenensis: SXIM_08040Help
Entry
SXIM_08040        CDS       T03904                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sxi  Streptomyces xiamenensis
Pathway
sxi00061  Fatty acid biosynthesis
sxi00780  Biotin metabolism
sxi01100  Metabolic pathways
sxi01130  Biosynthesis of antibiotics
sxi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sxi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SXIM_08040
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SXIM_08040
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SXIM_08040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sxi01004]
    SXIM_08040
Enzymes [BR:sxi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SXIM_08040
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SXIM_08040
Lipid biosynthesis proteins [BR:sxi01004]
 Fatty acid synthase
  Component type
   SXIM_08040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AKG42188
UniProt: A0A0F7FRP7
LinkDB All DBs
Position
complement(887037..887807)
Genome map
AA seq 256 aa AA seqDB search
MSGLLVGKRILVTGVLTESSIAFHTAKLAQQEGAEVVLTGFGRLSLVERIAKRLPKPAPV
IELDVQNKDQLASLADAVREHVDSLDGVVHSIGFAPQDALGGNFLNTEWESVATAVEVSA
YSLKSLTMALLPLLEQRGGSVVGMDFDAQVAWPKYDWMGVSKAALEATSRYLARDLGEKN
IRVNLVSAGPIKSMAAKSIPGFEELADVWNTRSPIGWDLEDPEPAARGVVALLSDWFPKT
TGEIVHVDGGVHMMGA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagtggacttcttgtcggtaagcgcatcctggtcaccggggtgctcaccgagtcgtcg
atcgccttccacaccgccaagctggcccagcaggagggtgccgaggtcgtcctgaccggt
ttcgggcggctctccctggtggagcggatcgccaagcggctgcccaagccggcgccggtg
atcgagctggacgtgcagaacaaggaccagctggcctcgctggccgacgcggtgcgcgag
cacgtcgactcgctcgacggtgtcgtgcactccatcggcttcgcgccgcaggacgcgctc
ggcggcaacttcctcaacaccgagtgggagtcggtggccacggcggtcgaggtctccgcc
tactccctcaagtcgctgacgatggcgctgcttccgctgctggagcagcgcggcggctcg
gtggtcggcatggacttcgacgcccaggtggcgtggcccaagtacgactggatgggcgtg
tccaaggcggcgctggaggccacctcgcgctacctcgcccgtgacctgggcgagaagaac
atccgcgtcaacctggtctcggccggccccatcaagtcgatggcggccaagtcgatcccc
ggtttcgaggagctggcggacgtgtggaacacccgctcgccgatcggctgggacctcgag
gaccccgagcccgcggcccgcggtgtggtggccctgctgtcggactggttcccgaagacc
accggcgagatcgtgcacgtcgacggtggcgtgcacatgatgggtgcctga

DBGET integrated database retrieval system