KEGG   Streptomyces xiamenensis: SXIM_28140Help
Entry
SXIM_28140        CDS       T03904                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sxi  Streptomyces xiamenensis
Pathway
sxi00250  Alanine, aspartate and glutamate metabolism
sxi00410  beta-Alanine metabolism
sxi00430  Taurine and hypotaurine metabolism
sxi00650  Butanoate metabolism
sxi01100  Metabolic pathways
sxi01110  Biosynthesis of secondary metabolites
sxi01120  Microbial metabolism in diverse environments
sxi02024  Quorum sensing
Module
sxi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sxi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SXIM_28140
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SXIM_28140
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SXIM_28140
   00430 Taurine and hypotaurine metabolism
    SXIM_28140
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SXIM_28140
Enzymes [BR:sxi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SXIM_28140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AKG44198
UniProt: A0A0F7FVD4
LinkDB All DBs
Position
3039247..3040611
Genome map
AA seq 454 aa AA seqDB search
MTQERTDQADDLYALPGSGRALPRYTLPEGPMPAREAYQLIRDELALDGNSRQNLATFCT
TWSEPEIRALMTETLDKNMVDKDEYPQTAELESRCVHILAALWHAPHGEAAVGCSTTGSS
EAAMLGGLALHRRWRARREAAGLPADRPNLVCGPVQVCWEKFARYFDIELRQMPLLPGRT
TADPAQLARYCDERTIGVVATLGVTFTGAYEPVEDIAAALDALAARTGVDIPIHVDAASG
GFVAPFLQPGLKWDFRVPRVKSVNCSGHKFGLAPLGVGWVVWRDAAELPAELVFHVDYLG
GDMPTFALNFSRPGGEIVAQYYNLLRLGRAGYQAVQRACADTAVALADSLAALGPFRVLH
DGRAGLPVVCWTLAPDHSTWTLYDLAERLRLRGWQVPTYPLPADRQETVVQRVVVRHGVS
RDLVQLLLEDMRGALAELGRHPAATAEQRPAFHH
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaggagcgtacggaccaggccgacgatctgtacgcgctgcccggcagcggccgg
gccctgccgcgctacaccctccccgaggggccgatgccggcccgcgaggcgtaccagctg
atccgtgacgagctggccctggacggcaactcccggcagaacctggccaccttctgcacc
acctggtccgagccggagatccgggcgctgatgacggagaccctcgacaagaacatggtg
gacaaggacgagtacccgcagaccgccgaactggagtcgcgctgcgtccacatcctcgcc
gcgctgtggcacgcgccgcacggcgaggcggccgtgggctgctccaccaccgggtcgagc
gaggcggcgatgctcggcgggctcgccctgcaccgccgctggcgggcgcggcgcgaggcg
gccgggctgcccgccgaccgccccaacctggtgtgcggcccggtgcaggtgtgctgggag
aagttcgcccgctacttcgacatcgagctgcggcagatgccgctgctgcccggccgcacg
accgccgatccggcgcagctggcccggtactgcgacgagcgcaccatcggcgtggtcgcc
accctcggggtgaccttcaccggcgcgtacgagccggtcgaggacatcgccgcggcgctg
gacgcgctggccgcccgcaccggggtcgacatcccgatccatgtggacgcggcgagcggc
ggcttcgtagccccgttcctccagcccggcctgaagtgggacttccgggtgccccgggtg
aagtccgtcaactgctcggggcacaagttcgggctcgcgccgctgggcgtgggctgggtg
gtgtggcgggacgccgccgaactgcccgccgaactcgtcttccacgtggactacctgggc
ggggacatgcccaccttcgcgctcaacttctcccgccccggcggggagatcgtcgcgcag
tactacaacctgctgcggctgggccgggccggctaccaggccgtgcagcgcgcctgcgcc
gacacggcggtggcgctggccgactccctcgccgccctcggaccgttccgggtgctgcac
gacggccgcgccgggctgccggtggtctgctggacgctggcgccggaccacagcacctgg
accctgtacgacctggccgaacggctgaggctgcgcggctggcaggtgcccacctatccg
ctgccggccgaccggcaggagaccgtggtgcagcgggtggtggtccggcacggggtgagc
cgcgatctggtgcagctgctgctggaggacatgcgcggggcgctggccgagctgggccgc
catccggcggccacagcagagcagcgccccgcgttccatcactga

DBGET integrated database retrieval system