KEGG   Streptomyces xiamenensis: SXIM_34090Help
Entry
SXIM_34090        CDS       T03904                                 

Definition
(GenBank) Isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sxi  Streptomyces xiamenensis
Pathway
sxi00020  Citrate cycle (TCA cycle)
sxi00480  Glutathione metabolism
sxi01100  Metabolic pathways
sxi01110  Biosynthesis of secondary metabolites
sxi01120  Microbial metabolism in diverse environments
sxi01130  Biosynthesis of antibiotics
sxi01200  Carbon metabolism
sxi01210  2-Oxocarboxylic acid metabolism
sxi01230  Biosynthesis of amino acids
Module
sxi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sxi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sxi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SXIM_34090
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SXIM_34090
Enzymes [BR:sxi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SXIM_34090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AKG44793
UniProt: A0A0F7FW70
LinkDB All DBs
Position
complement(3644000..3645223)
Genome map
AA seq 407 aa AA seqDB search
MAKIKVANPVVELDGDEMTRIIWQFIKDKLILPYLDVELKYYDLGIEHRDATNDQVTVDA
AEAIKQYGVGVKCATITPDEARVEEFGLKRMYRSPNGTIRNILGGVIFREPIIMENVPRL
VPGWTKPIVVGRHAFGDQYRATDVKIPGEGTLTLSFTPKDGSEPMELEVYDFPSSGVALA
MYNLDDSIRDFARSSFRYGLERNFPVYMSTKNTILKAYDGRFKDLFQEVFDAEFKAEFDA
RGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDIVAQGFGSLGLMTSVLMTPDGK
TVEAEAAHGTVTRHYRQHQQGKATSTNPIASIFAWTRGLAHRGKLDNTPEVTEFAHKLEQ
VCIETVEAGQMTKDLALLIGKDQPWLTTEEFLAALDENLKKKIAATA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatcaaggtagccaaccccgtcgtcgaactcgacggcgacgagatgacccgc
atcatctggcagttcatcaaggacaagctgatccttccgtacctcgacgtcgagctgaag
tactacgacctcggcatcgagcaccgcgacgccaccaacgaccaggtgacggtcgacgcg
gccgaggccatcaagcagtacggcgtcggcgtgaagtgcgccaccatcaccccggacgag
gcgcgggtcgaggagttcggcctcaagcgcatgtaccgctcgcccaacggcaccatccgc
aacatcctgggcggtgtcatcttccgcgagccgatcatcatggagaacgtgccgcgtctg
gtcccgggctggaccaagccgatcgtcgtcggccgtcacgccttcggcgaccagtaccgc
gccaccgacgtcaagatccccggcgagggcaccctgaccctgtccttcaccccgaaggac
ggctccgagcccatggagctggaggtctacgacttcccgagctccggtgtcgccctggcc
atgtacaacctggacgactccatccgcgacttcgcgcggtcctccttccggtacggcctg
gagcgcaacttcccggtctacatgtccaccaagaacacgatcctcaaggcctacgacggc
cgcttcaaggatctgttccaggaggtcttcgacgccgagttcaaggcggagttcgacgcg
cgcgggctcacctacgagcaccggctgatcgacgacatggtcgccgccgccctgaagtgg
gagggcggctacgtgtgggcctgcaagaactacgacggtgacgtgcagtccgacatcgtc
gcccagggcttcggctcgctgggcctgatgacctccgtgctgatgacccccgacggcaag
accgtcgaggccgaggccgcgcacggtacggtcacccgccactaccggcagcaccagcag
ggcaaggcgacctccaccaacccgatcgcctcgatcttcgcctggacccggggcctggcc
caccgcggcaagctcgacaacacccccgaggtgaccgagttcgcgcacaagctggagcag
gtctgcatcgagaccgtcgaggccggtcagatgaccaaggacctggcgctgctcatcggc
aaggaccagccgtggctgaccaccgaggagttcctcgccgctctcgacgagaacctgaag
aagaagatcgccgccaccgcgtaa

DBGET integrated database retrieval system