KEGG   Streptomyces xiamenensis: SXIM_47860Help
Entry
SXIM_47860        CDS       T03904                                 

Definition
(GenBank) class III aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sxi  Streptomyces xiamenensis
Pathway
sxi00250  Alanine, aspartate and glutamate metabolism
sxi00410  beta-Alanine metabolism
sxi00640  Propanoate metabolism
sxi00650  Butanoate metabolism
sxi01100  Metabolic pathways
sxi01120  Microbial metabolism in diverse environments
Module
sxi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sxi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SXIM_47860
   00650 Butanoate metabolism
    SXIM_47860
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SXIM_47860
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SXIM_47860
Enzymes [BR:sxi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SXIM_47860
Amino acid related enzymes [BR:sxi01007]
 Aminotransferase (transaminase)
  Class III
   SXIM_47860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AKG46170
UniProt: A0A0F7FZC1
LinkDB All DBs
Position
complement(5143056..5144384)
Genome map
AA seq 442 aa AA seqDB search
MSARTGSLHERHRAVLPRWLTLYYERPLELTHGAGRHVWDADGNRYLDFFGGILTTMTAH
ALPEVAKAVGEQAQRLVHSSTLYLSRPMVELAERIADLSGIEDARVFFTTSGTEANDAAL
LLASAYRGGANQVLAMRNSYHGRSFSTVGITGNAAWSPTTLSPLQTLYVHGGVRTRGPYA
ALPDEEFIAAAVADLEDMLAHTRPAGVAALIAEPVQGVGGFTSGPDGLFAAFREVLAREG
IVWISDEVQTGWGRTGDHFWGWQAHAAAGPPDLLTFAKGIGNGMSIGGVVGRADIMDALD
ANSISTFGGSPVTMAAGLANLGYLLEHDLQSNARRVGAELRERLVAGAEDLALVREVRGR
GLMIAVEVVRPGTGEPDPAVAALVLERAREAGLLIGKGGGPGGSVLRIAPPLSLTGEEAR
EGAELLVAALAGVDAELAGRNG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcggaccggctccctgcacgagcggcaccgggccgtcctgccgcggtggctc
acgctctactacgagcggccgctggagctcacgcacggcgcgggccggcatgtgtgggac
gcggacggcaaccgctatctggacttcttcggcggcatcctgacgacgatgacggcgcac
gcgctgccggaggtggcgaaggcggtcggcgagcaggcgcagcgcctggtgcactcctcg
acgctgtatctgagccgtccgatggtggaactggcggagcggatcgcggatctgtcgggg
atcgaggacgcccgggtgttcttcacgacgtcgggcaccgaggcgaacgacgcggcgctg
ctgctggcctcggcgtaccgcgggggcgccaaccaggtgctggcgatgcgcaacagctac
cacgggcggtccttctccacggtggggatcaccggcaacgcggcctggtcgccgaccacc
ctctcgccgctgcagaccctgtacgtgcacggcggtgtacggacgcgtggcccgtacgcc
gcgttgccggacgaggagttcatcgcggcggcggtggccgacctggaggacatgctggcg
cacacccgcccggccggggtggcggcgctgatcgccgaacccgtgcagggggtgggcggt
ttcacctccgggcccgacgggctgttcgcggccttccgtgaggtgctggcgcgggagggg
atcgtgtggatcagcgacgaggtgcagacggggtggggccgtaccggtgaccacttctgg
ggctggcaggcgcacgcggcggccgggccgcccgacctgctgacgttcgcgaagggcatc
ggcaacgggatgtcgatcgggggcgtggtggggcgcgcggacatcatggacgcgctggac
gcgaactccatctcgacgttcggcggcagtccggtgacgatggcggccgggctggcgaac
ctggggtatctgctggagcacgacctgcagtcgaacgcccgccgggtgggggcggaactc
cgcgagcgcctggtggcgggcgcggaagacctcgcgctggtacgggaggtacgcgggcgc
ggtctgatgatcgccgtcgaggtggtgcggccggggaccggtgagccggatccggcggtg
gcggccctggtcctggagcgggcccgggaggcggggctgctgatcggcaagggcggcggg
cccggtgggagtgtcctgcggatcgcgccgccgctgagcctgaccggggaggaggcgcgc
gagggcgcggaactgctggtggccgccctggccggggtggacgcggaactggcggggcgg
aacgggtag

DBGET integrated database retrieval system