KEGG   Streptomyces xiamenensis: SXIM_50860Help
Entry
SXIM_50860        CDS       T03904                                 

Definition
(GenBank) atp-dependent dna ligase
Organism
sxi  Streptomyces xiamenensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AKG46470
UniProt: A0A0F7FZZ3
LinkDB All DBs
Position
5473968..5475041
Genome map
AA seq 357 aa AA seqDB search
MDLPVMPPVSPMLAKPAAKIPAGMHYEAKWDGFRAIVFRDGAELEIGSRTGKPLTRYFPE
LEQGLRAALPERCVVDGEIVIARGGRLDFDALLERIHPADSRVRTLAERTPASFVAFDLL
ALGSDSLLDTPLAERRTALTDALRHTHRPVFIAPATRDIDLARQWYERYEGAGLDGVVAK
PLDLTYRPGERVMVKVKHERTADCVVAGVRRHKSGEGVGSLLLGLYDTTGRLQHVGVCAS
FTARRRAELMTELTPLLMDSAEGHPWADWADGAAHEHARMPGAPSRWTGTKDLSWLPLRP
ERVCEVRYDHMQGDRFRHTAHFLRWRPDRDPADCGYAQLEEPVGYELDDILTPHHPH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaccttccggtgatgccccccgtcagccccatgctcgccaagcccgccgcgaagatc
cccgccggcatgcactacgaggccaagtgggacggcttccgcgccatcgtcttccgcgac
ggcgccgagctggagatcggctcccgcaccggcaagccgctcacccgctacttccccgaa
ctcgaacaaggactgcgcgccgccctgcccgagcgctgcgtggtcgacggcgagatcgtc
atcgcccgtggcggccggctcgacttcgacgccctgctggaacgcatccacccggccgac
tcccgggtccggacgctggccgaacgcacccccgcctccttcgtcgccttcgacctcctg
gccctcggctccgactccctcctggacaccccgctcgccgaacgccgcaccgcgctcacc
gacgcgctgcgccacacccaccggcccgtcttcatcgctcccgccacccgcgacatcgac
ctggcccggcagtggtacgaacgctacgagggcgccggcctggacggcgtcgtcgccaag
cccctggacctcacctaccggccgggcgaacgcgtcatggtgaaggtcaagcacgagcgc
accgcggactgcgtcgtcgccggggtgcgccgccacaagagcggtgagggcgtcggctcc
ctgctgctcggcctgtacgacaccaccggccgcctccagcacgtcggggtgtgcgcctcg
ttcaccgcccggcgccgcgccgagctgatgaccgagctgaccccgctgctgatggactcc
gccgagggccatccgtgggccgactgggcggacggcgcggcccacgagcacgcccggatg
cccggtgcccccagccgctggaccggcaccaaggacctcagctggctgccgctgcggccc
gagcgggtgtgcgaggtgcggtacgaccacatgcagggggaccggttccggcacaccgcg
cacttcctgcgctggcggcccgaccgtgacccggccgactgcgggtacgcccagctggag
gagccggtgggctacgagctcgacgacatcctcaccccgcaccatccgcactga

DBGET integrated database retrieval system