Streptomyces xiamenensis: SXIM_52710 Help Entry SXIM_52710        CDS       T03904                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism sxi  Streptomyces xiamenensis Pathway sxi00261   Monobactam biosynthesis sxi01100   Metabolic pathways sxi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sxi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SXIM_52710  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sxi01008]     SXIM_52710 Polyketide biosynthesis proteins [BR:sxi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SXIM_52710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AKG46655 UniProt:  A0A0F7G0I2 LinkDB All DBs Position 5733053..5733274 Genome browser AA seq 73 aa AA seqDB search MNANPFEDESADYLAVVNAEGQHSLWPAFAEVPLGWNVVAGPAGREDCLRFITENWQDMR PKSLVAALSRSAG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaacgccaaccctttcgaggatgagtccgccgactacctggccgtggtcaacgccgag ggacagcactcgctgtggccggcgttcgccgaggtgccgctgggctggaacgtcgtcgcc ggtcctgccggccgcgaggactgtctgcgattcatcacggagaactggcaggacatgcgg cccaagagcctggtggccgcgctctcgcggtcggccggctga

DBGET integrated database retrieval system