KEGG   Staphylococcus xylosus SMQ-121: SXYLSMQ121_0559Help
Entry
SXYLSMQ121_0559   CDS       T03311                                 

Definition
(GenBank) Sorbitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
sxl  Staphylococcus xylosus SMQ-121
Brite
KEGG Orthology (KO) [BR:sxl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SXYLSMQ121_0559
Enzymes [BR:sxl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SXYLSMQ121_0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C PALP AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AID41991
UniProt: A0A418I6C7
LinkDB All DBs
Position
647818..648900
Genome map
AA seq 360 aa AA seqDB search
MTKKNYPEQMNAVVAYAPGEYKYETVETPKIENSKEIIVKVEACGICAGDIKAYDGAPSF
WGDETQPSYIKAPMIPGHEFIARIVEKGDDVIDFEIGDRVISEQIVPCWECRFCNRGEYW
MCEKHDLYGFQNNVNGGMAEYMKFTKEAINYKVPEDMPIEKAILIEPYACSLHAVQRANI
KLGDFVVLSGAGTLGLGMVGAAKKAGAETLVVLDMKDERLELAKEFGADIVMNPAKVDVV
KEIKSMTEGYGCDTYIEATGHPKSVEQGLSAIRKLGRFVEFSVFADPVTVDWSIISDRKE
LDLMGSHLGPYCYPLVIDGIQKDDFPTDGVVTHQLSLKDFEQGFDLMKKGDKSLKIVLVP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgactaagaaaaattatccagaacaaatgaatgctgttgtagcttatgcacctggtgaa
tataaatatgaaacagttgaaactccgaaaatagaaaattcaaaagaaattatcgtaaag
gtagaagcatgtggcatctgcgcaggtgatattaaagcctatgatggtgcgccaagtttt
tggggtgatgaaacacagccatcatacattaaagcaccgatgattccagggcatgaattt
attgctcgtattgttgaaaagggcgatgatgttatagattttgaaattggtgatcgtgta
atttctgaacaaatcgtaccttgttgggaatgtagattctgtaatcgtggagaatattgg
atgtgtgaaaaacatgacttatatggcttccaaaataatgtgaacggcggtatggcagag
tatatgaaattcacaaaagaagcaatcaattataaagtgcctgaggatatgcctatagaa
aaagcaattttaattgaaccatacgcctgtagtttacatgcggtacaacgtgccaacatt
aaattaggagattttgttgtactttcaggtgccggaacattaggtttaggcatggtaggt
gcagctaaaaaagcaggtgctgagacattggttgtcttagacatgaaagatgaaagatta
gaactagctaaggaatttggtgctgatatcgtaatgaatccagctaaagttgatgttgtg
aaagaaatcaagtcaatgacggaaggatatggctgtgacacatatattgaagctacaggt
catcctaaatccgttgagcaaggtttgagtgcaatcagaaagttaggtcgttttgtagaa
ttctctgtatttgctgatccagtaacagtagattggagtattatttcagaccgtaaagaa
ttagatttgatgggtagccacttggggccttattgctatccactagtcattgatgggatt
caaaaagatgactttccaactgatggtgtagtcacacatcaattatctttaaaagatttt
gaacaaggatttgatttgatgaaaaaaggagacaaatcattaaaaattgttcttgtacct
taa

DBGET integrated database retrieval system