KEGG   Staphylococcus xylosus SMQ-121: SXYLSMQ121_0796Help
Entry
SXYLSMQ121_0796   CDS       T03311                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sxl  Staphylococcus xylosus SMQ-121
Pathway
sxl00010  Glycolysis / Gluconeogenesis
sxl00053  Ascorbate and aldarate metabolism
sxl00071  Fatty acid degradation
sxl00280  Valine, leucine and isoleucine degradation
sxl00310  Lysine degradation
sxl00330  Arginine and proline metabolism
sxl00340  Histidine metabolism
sxl00380  Tryptophan metabolism
sxl00410  beta-Alanine metabolism
sxl00561  Glycerolipid metabolism
sxl00620  Pyruvate metabolism
sxl00625  Chloroalkane and chloroalkene degradation
sxl01100  Metabolic pathways
sxl01110  Biosynthesis of secondary metabolites
sxl01120  Microbial metabolism in diverse environments
sxl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SXYLSMQ121_0796
   00053 Ascorbate and aldarate metabolism
    SXYLSMQ121_0796
   00620 Pyruvate metabolism
    SXYLSMQ121_0796
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SXYLSMQ121_0796
   00561 Glycerolipid metabolism
    SXYLSMQ121_0796
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SXYLSMQ121_0796
   00310 Lysine degradation
    SXYLSMQ121_0796
   00330 Arginine and proline metabolism
    SXYLSMQ121_0796
   00340 Histidine metabolism
    SXYLSMQ121_0796
   00380 Tryptophan metabolism
    SXYLSMQ121_0796
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SXYLSMQ121_0796
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SXYLSMQ121_0796
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SXYLSMQ121_0796
Enzymes [BR:sxl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SXYLSMQ121_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra
Motif
Other DBs
NCBI-ProteinID: AID42228
LinkDB All DBs
Position
883925..885352
Genome map
AA seq 475 aa AA seqDB search
MRNFTKQYINGEWVESASGETIEVINPATEEVAGTIAKGNKEDVDKAVDAAENVYFEFRH
SSVQERRELLDKIVQEYKNRKEDIIEAITDELGAPLDVSENVHYRMGLDHFEAARDALDN
FEFEERRGDDLVVKEAIGVAGLITPWNFPTNQTSLKLSAAFAAGSPVVLKPSEETPFAAI
ILAEIFDKVGVPKGVFNLVNGDGQGVGNPLSEHPKVRMMSFTGSGPTGSSIMKKAADDFK
KVSLELGGKSPYIILDDVDIDKAASAATGKVVTNTGQVCTAGTRTLVPESIKEEFLTAVK
EQFSQVKVGDPRAEGTEVGPIISKKQFDQVQSYIDKGVEEGAELFYGGPGKPEGLDKGYF
ARPTIFNNVDNDMTIAREEIFGPVMSIITYNDVDEAIKIANDTEYGLAAYVYGKDQDTLH
KVARSLEAGTVEINEAGRKPDLPFGGYKQSGIGREWGDYGIEEFLEVKSIAGYYK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttcactaaacaatatatcaacggtgaatgggttgaaagtgcaagtggcgaa
acgatagaagtcatcaatccagcaacagaagaagtagcgggcacaatcgcgaaaggtaac
aaagaagatgttgataaagcagtggatgcagcagagaatgtatattttgaatttagacac
agttcagttcaagaaagaagagaactattagataaaattgttcaagagtataaaaataga
aaagaagatattatagaagctattactgatgaactaggtgcgccattagacgtatcagaa
aatgtccattatcgaatgggactagatcactttgaagcagcacgtgatgcattagataat
tttgaatttgaagagcgccgtggcgatgatttagttgtcaaagaagcaattggtgtagct
ggtttaatcacaccttggaacttccctacaaaccaaacgtctcttaaattatcagcagca
tttgcagcaggaagtccggtagttttaaaaccatcggaagaaactccatttgcagcaatt
attttagctgaaatttttgataaagtaggcgtgccaaaaggtgtgtttaacttagtcaat
ggtgatggtcaaggcgtagggaatcctttaagtgaacatcctaaagttagaatgatgtca
tttactggctctggcccaactggctcaagtattatgaagaaagccgcggatgattttaaa
aaagtatcacttgaactaggtggtaaatcaccatatattatcttagatgatgtagatata
gataaagcagcaagtgcagcaactggtaaagttgttacaaatactggtcaagtatgtaca
gcgggtactagaacacttgtacctgaaagtattaaagaagagttcttaacagctgtaaaa
gagcaatttagccaagttaaagtaggagacccacgtgcagaaggcacagaagttggacct
atcattagtaaaaaacaatttgatcaagtgcaatcatatattgataaaggcgtagaagag
ggtgcagaattattttacggtggccctggtaaaccagaaggtctggacaaaggatacttt
gcacgtccaacaatctttaacaatgtagataatgatatgacgatcgctcgagaagaaata
tttggtcctgttatgtcaattatcacttataatgatgtagacgaagctattaaaatcgca
aatgacacagaatatggtttagctgcatatgtatatggtaaagatcaagataccttacac
aaggtagcgcgttcattagaagctggtacagttgaaattaatgaagcaggacgcaaacca
gatttaccattcggtggctacaaacaatcaggtattggccgtgaatggggagactatggt
attgaagaattcctagaagttaaatctattgcaggttactataaataa

DBGET integrated database retrieval system