KEGG   Staphylococcus xylosus SMQ-121: SXYLSMQ121_0984Help
Entry
SXYLSMQ121_0984   CDS       T03311                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
sxl  Staphylococcus xylosus SMQ-121
Brite
KEGG Orthology (KO) [BR:sxl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SXYLSMQ121_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AID42415
LinkDB All DBs
Position
1080415..1081203
Genome map
AA seq 262 aa AA seqDB search
MTIIILLIIGLVSSIIGSLIGVGGGIIIVPTLVFIGANFDLLSGITTQTAIGISSVTLVF
TGLFSIIAYRGKGKDAIDFRNGILFSIGIIPGSLLGAYLSQFLNDIYFNIIFGIFLFLIS
ILLFIKDYLASKKDSTTEKNVNLTLGIIFAFFVGISAGLFGIGGGVLMTPLMIIVFNFTP
HVAVATSMIIIFTSSLASSVGHVIQGHVIWGYGLILIIASYVGTKCGVKINRSINSAKLS
NLLKFVLICLSIYLIIKGFIEL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacaattataatattgcttataataggactcgtttcttctattataggttctttaatc
ggtgttggtggaggtattatcattgtacctacgctagtttttataggtgcaaattttgat
ttattaagtggtattacaactcaaactgcaattggtatatcatctgtgacgcttgttttt
acaggtttattttcaataattgcttaccggggcaaaggcaaagatgcgattgattttaga
aatggtattttattttctattggtattattcccggatcgttattaggggcttacctaagt
caatttcttaatgatatatactttaatattatatttggtatatttttatttttaatttca
atcttactttttataaaagactacttagcatctaaaaaggacagtactacagaaaaaaat
gtgaatctaacattaggaattatttttgcattttttgtaggtatcagtgctggtttgttt
ggaattggtggcggtgtgttaatgacgccgttaatgattattgttttcaacttcacacca
cacgtagctgtggcaacaagtatgattattatttttacttcaagtttagcaagttcagta
ggacatgtgattcaaggacatgtgatttggggctatggattgatattaatcattgcaagt
tatgtaggaacaaaatgcggtgtgaaaattaatagatcaattaattctgcaaagttatcc
aacttacttaaatttgttttgatttgtttaagtatctatttaattatcaaaggatttatt
gaattgtaa

DBGET integrated database retrieval system