KEGG   Staphylococcus xylosus SMQ-121: SXYLSMQ121_1338Help
Entry
SXYLSMQ121_1338   CDS       T03311                                 

Definition
(GenBank) Cell division protein GpsB, coordinates the switch between cylindrical and septal cell wall synthesis by re-localization of PBP1
Organism
sxl  Staphylococcus xylosus SMQ-121
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DivIVA YabA HMMR_C Leu_zip HOOK ZapB LRRFIP DASH_Spc19 DivIC CtIP_N GPS2_interact bZIP_1 Ax_dynein_light TMCO5 bZIP_2 DUF4855 DUF2400 DUF2381 SlyX Seryl_tRNA_N CENP-H Cnn_1N DUF4407
Motif
Other DBs
NCBI-ProteinID: AID42769
UniProt: A0A418IAT6
LinkDB All DBs
Position
1453621..1453980
Genome map
AA seq 119 aa AA seqDB search
MSDVSLKLSAKDIYEKDFEKTMTRGYRREEVDAFLDDIIADYQKMADLDNEVVKLSEENN
KLKKELEELRLRVATSRPQENKNFSSNSNATTKSNTNNNNNNVDILKRISNLEKAVFGK
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtttcattaaaattatcagcaaaagatatttatgaaaaagattttgaaaaa
actatgactcgtggctatagaagagaagaagtagatgccttcttagacgatattatagcg
gattatcaaaaaatggcagatttagataatgaagttgtaaaactttcagaagaaaacaat
aaacttaaaaaagaattagaagagttacgtttacgtgttgctacatcgagaccacaagaa
aataaaaatttctcttcaaacagtaatgcaactactaaaagcaatactaataacaacaat
aacaatgttgatattttaaaacgaatatctaaccttgaaaaagcagttttcggaaaataa

DBGET integrated database retrieval system