KEGG   Staphylococcus xylosus SMQ-121: SXYLSMQ121_1591Help
Entry
SXYLSMQ121_1591   CDS       T03311                                 

Definition
(GenBank) Serine/threonine protein kinase PrkC, regulator of stationary phase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sxl  Staphylococcus xylosus SMQ-121
Brite
KEGG Orthology (KO) [BR:sxl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sxl01001]
    SXYLSMQ121_1591
Enzymes [BR:sxl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SXYLSMQ121_1591
Protein kinases [BR:sxl01001]
 Serine/threonine kinases: Other
  Bacterial family
   SXYLSMQ121_1591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kdo Seadorna_VP7 Kinase-like DUF1676 Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AID43022
LinkDB All DBs
Position
complement(1730508..1732553)
Genome map
AA seq 681 aa AA seqDB search
MIGKIINERYKVTKKLGGGGMSRVYLAEDSILKRSVAIKAIRIPPGEKEEAIKRFEREVH
NLTQLSHNNIVNVFDVTEDDENFYLVMEYIEGLTLSEYIQKNHPLDVDTILNFINQIING
IKHAHDTKIVHRDIKPQNILVDKDETLKILDFGIAKALSETTMTETNHVLGTVQYLSPEQ
ARGDITDNGTDIYSMGVVLYEMLIGKPPFSGETAVSIAIKHIQDPMPNVTDERSDIRQAL
SNVVLKATEKDKMERYQSVREMQNDLETVMSDERASEDRYQSSITSTKTVPINKSEIANQ
TREEDKGKSISETMQIPIVNQQQFQSSEEHIYAVPRKKRSKKKKFLYTLIIVLLLFGLFS
FMAMGMFGNKYLETPDITGKTEKEAEHILKEHKLQMGKTTREYSDKYPENKIIKTKPEKG
ERLEQNSKVDIVMSKGPQLAEMPSLYGMSKSDAISKLKDLGIKDTKVKQSYTKQNVAKGL
IESQNISPGDKVKVNDSNIELIESLGTKQVYVDDYENKSFKAAKEDLESKGFKVEVSEER
NDDKVKKDDVISQSPKGEEVDEGSTISFVVSKGKEETKEEPKDDAKDKDKDKDDSKDEEA
ATKEYTETYQVQYTGDDDKSQEVKVYIRDKDDQGSSAAQTYKIKENKTIKIPMTIEKGKT
AGFTIRVDDKVVADKDIPYDF
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgataggcaaaataattaatgaacgttacaaagtaactaaaaaacttggtggcggtgga
atgagcagagtctatcttgctgaagactcgatcctcaaacgaagtgttgcaattaaagct
ataagaattccgccaggtgaaaaagaagaagcaattaaaagatttgagcgagaagtacat
aatttaacgcaattatcccataataatattgttaatgtctttgatgttacagaagatgat
gaaaacttctatttagttatggaatatattgaaggtttaacattatcggaatacattcaa
aagaatcatccattagatgtagacacaatattaaattttataaatcaaattatcaatggt
attaaacacgctcatgatacaaaaattgtgcacagagatattaaaccgcaaaatatttta
gtggataaagatgaaacattaaaaatattggattttggtatagctaaagcattaagtgaa
acaacaatgacagaaacaaatcatgtgttaggtactgtccaatatctatctccagaacaa
gcacgtggagatattacagataatggcacagatatctattcaatgggtgttgtattatat
gaaatgcttattggtaaaccgccattttctggagaaacagctgtcagtattgctataaag
catattcaagatcctatgcctaatgtaactgatgaacgttcagatattcgtcaagcttta
agtaatgttgtactaaaagcaactgaaaaagacaagatggagcgttaccaatcagtaaga
gaaatgcaaaatgatttagaaactgttatgtcagatgaacgtgcatcagaagacagatat
caatcttctatcacgagtactaaaacagtaccgataaataaatcagaaattgctaatcaa
acacgcgaagaagacaaagggaagagcattagtgagacaatgcaaattcctattgtcaat
caacaacaatttcaatccagtgaagaacatatctatgcagttcctagaaagaaacgttct
aagaaaaagaaatttttatatactttaattattgttttgttgttatttggtctgtttagc
tttatggctatgggtatgtttggtaacaaatatttagaaacgccagatataactggcaaa
actgaaaaagaagccgaacatattttaaaagaacataaattacaaatgggtaaaactact
cgtgagtatagtgataaataccctgaaaataaaataataaaaacgaagcccgaaaaaggc
gagcgactagagcaaaacagtaaagttgatattgtgatgtctaaaggaccacaattagct
gaaatgccaagtttatatggtatgtcaaaatctgatgcaatcagtaaactgaaagattta
ggtataaaagatactaaagttaaacaatcttataccaaacaaaatgtagctaaaggttta
attgaatcacaaaacatttcacctggtgataaagtgaaagttaatgacagtaatattgaa
ttaattgagtcattaggaaccaaacaagtttatgttgatgattatgaaaataaatccttt
aaagctgctaaagaagacctagaatctaaaggctttaaagtagaagtttcagaagaaaga
aatgatgataaagtcaaaaaagatgacgttattagccagtcaccaaaaggtgaggaagta
gatgaaggttctacgatatcctttgtcgtatctaaaggtaaagaagagactaaagaagaa
cctaaggatgacgctaaagacaaagataaagataaagacgattctaaagatgaagaagct
gcaacgaaagaatatactgaaacataccaagtgcaatatactggtgatgatgataaaagc
caagaagtgaaagtatatattagagataaagatgaccaagggtcatcagcagcacagact
tataagattaaagaaaacaagactattaagataccaatgacaattgaaaaaggtaagacg
gctggttttactattcgagttgatgataaggttgttgctgataaagatattccttatgat
ttttag

DBGET integrated database retrieval system