KEGG   Staphylococcus xylosus SMQ-121: SXYLSMQ121_1697Help
Entry
SXYLSMQ121_1697   CDS       T03311                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sxl  Staphylococcus xylosus SMQ-121
Pathway
sxl00010  Glycolysis / Gluconeogenesis
sxl00020  Citrate cycle (TCA cycle)
sxl00620  Pyruvate metabolism
sxl01100  Metabolic pathways
sxl01110  Biosynthesis of secondary metabolites
sxl01120  Microbial metabolism in diverse environments
sxl01130  Biosynthesis of antibiotics
sxl01200  Carbon metabolism
Module
sxl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SXYLSMQ121_1697
   00020 Citrate cycle (TCA cycle)
    SXYLSMQ121_1697
   00620 Pyruvate metabolism
    SXYLSMQ121_1697
Enzymes [BR:sxl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SXYLSMQ121_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H ATP-synt_ab_Xtn HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AID43128
LinkDB All DBs
Position
complement(1844333..1845631)
Genome map
AA seq 432 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVL
VDEGTVAVVGDTIVKIDAPDAEDMQFKGSESDEAASEETEAPAEETTSEAPAQSSNDEEV
DESKRVKAMPSVRKYAREKGVNIKAVSGSGKNGRTTKEDVDAYLNGGQATASNESAAATS
EETTSTSASQPAAVSTEGEYPETTEKIPAMRKAIAKAMVNSKHTAPHVTLMDEIDVQELW
DHRKKFKEVAAEQGTKLTFLPYVVKALVSALKKYPALNTEFNEEAGEIVHKHYWNIGIAA
DTDRGLLVPVVKNADRKSMFAISDEINELAVKARDGKLSADEMKGATCTISNIGSAGGQW
FTPVINHPEVAILGIGRIAQKPIVKDGEIIAAPVLSLSLSFDHRQIDGATGQNAMNHIKR
LLNNPELLLMEG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaattacccgacattggtgaaggtatccacgaaggtgaaattgta
aaatggtttgttaaagctggagatacaattgaagaagacgatgtattagcagaagtacaa
aacgacaaatcagttgtagaaattccatctcctgtttcaggtactgttgaagaagtttta
gtagacgaaggtactgtagcagttgttggtgatacaattgttaaaatcgacgcaccagat
gcagaagacatgcaatttaaaggtagcgaaagtgacgaagctgctagcgaagaaacagaa
gcgccagcagaagaaactacatcagaagcacctgctcaatcttcaaatgatgaagaagta
gatgaaagcaaacgcgttaaagcgatgccttcagttcgtaaatacgcacgtgaaaaaggc
gttaatattaaagctgtttcaggttcaggtaaaaacggacgcactactaaagaagacgtt
gacgcttacttaaatggtggtcaagcaactgcttctaacgaaagtgcagcagctactagc
gaagaaacaactagcacaagtgcttcacaaccagcagcagtttctactgaaggtgaatac
ccagaaactactgaaaaaattcctgcaatgcgtaaagcaattgctaaagcaatggttaac
tcaaaacacactgcaccacacgtaacattaatggatgaaattgatgttcaagaattatgg
gatcaccgtaaaaaattcaaagaagttgcagctgagcaaggtactaaattaactttctta
ccttacgttgtaaaagcacttgtttctgcacttaaaaaatatccagcacttaacacagaa
ttcaacgaagaagctggcgaaatcgtgcataaacattactggaatattggtatcgcagct
gatactgatagaggtttattagtaccagtagttaaaaatgctgatcgcaaatctatgttt
gcaatttcagacgaaattaatgaacttgctgttaaagctcgtgatggtaaattatcagct
gatgaaatgaaaggtgctacttgtacaatcagtaacatcggttcagctggtggacaatgg
ttcacgccagttatcaatcacccagaagttgcaattttaggtattggacgcattgcacaa
aaacctatcgttaaagatggtgaaattattgcagctccagtattatcattatcattaagc
tttgaccacagacaaattgatggtgctactggacaaaatgctatgaatcatattaaacgt
ttattaaataatccagaattattattaatggaggggtaa

DBGET integrated database retrieval system