KEGG   Staphylococcus xylosus C2a: SXYL_00514Help
Entry
SXYL_00514        CDS       T03742                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sxo  Staphylococcus xylosus C2a
Pathway
sxo00010  Glycolysis / Gluconeogenesis
sxo00260  Glycine, serine and threonine metabolism
sxo00680  Methane metabolism
sxo01100  Metabolic pathways
sxo01110  Biosynthesis of secondary metabolites
sxo01120  Microbial metabolism in diverse environments
sxo01130  Biosynthesis of antibiotics
sxo01200  Carbon metabolism
sxo01230  Biosynthesis of amino acids
Module
sxo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sxo_M00002  Glycolysis, core module involving three-carbon compounds
sxo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sxo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SXYL_00514 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    SXYL_00514 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SXYL_00514 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sxo04131]
    SXYL_00514 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sxo04147]
    SXYL_00514 (gpmA)
Enzymes [BR:sxo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SXYL_00514 (gpmA)
Membrane trafficking [BR:sxo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SXYL_00514 (gpmA)
Exosome [BR:sxo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SXYL_00514 (gpmA)
  Exosomal proteins of melanoma cells
   SXYL_00514 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CEF17941
LinkDB All DBs
Position
Chr1:576216..576902
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSVWNAENLFTGWADVDLSDQGKNEAITSGKKLKDQGIEIDIVYTSLLER
AIKTTFHLLNESDQLFIPVIKSWRLNERHYGDLQGLNKDDAREKFGEEQVHIWRRSYDVA
PPKQGEEQRNDYLNDRKYEHLDRRVMPESESLKDTLIRVIPYWNDQISQQLLDGKTVLVS
AHGNSLRALIKYLEDVSDEDIISYEIKTGAPLIYELTDDLQVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtagacatggacaaagtgtttggaatgctgaaaatttattt
acaggatgggcagatgtagatttatctgatcaaggtaaaaacgaggctattacttctggt
aaaaaactaaaagatcaaggtattgaaattgatattgtatatacctctttactagaaaga
gcaattaagactacgtttcatcttttaaatgaatctgatcaattatttatcccagttata
aagtcgtggagactaaatgaaagacattatggtgatttgcagggtctgaataaagatgac
gcacgtgaaaaatttggcgaagaacaagtacatatttggagacgctcttatgacgttgcg
ccacctaaacaaggtgaagaacaaagaaatgattatttaaatgatagaaaatatgagcat
ttagatagaagagttatgcctgaatcagaaagtttgaaagatacattaataagagtaatt
ccctattggaatgatcaaatctctcaacaacttttagacggtaaaaccgtgctcgtttcc
gcacatggtaattcattacgtgcgcttatcaaatatttggaagatgtatctgatgaagat
attattagctatgaaataaaaacaggtgcaccattaatatatgaattgacagatgattta
caggtaatagataagtattatttataa

DBGET integrated database retrieval system