KEGG   Staphylococcus xylosus C2a: SXYL_00811Help
Entry
SXYL_00811        CDS       T03742                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sxo  Staphylococcus xylosus C2a
Pathway
sxo00010  Glycolysis / Gluconeogenesis
sxo00053  Ascorbate and aldarate metabolism
sxo00071  Fatty acid degradation
sxo00280  Valine, leucine and isoleucine degradation
sxo00310  Lysine degradation
sxo00330  Arginine and proline metabolism
sxo00340  Histidine metabolism
sxo00380  Tryptophan metabolism
sxo00410  beta-Alanine metabolism
sxo00561  Glycerolipid metabolism
sxo00620  Pyruvate metabolism
sxo00625  Chloroalkane and chloroalkene degradation
sxo01100  Metabolic pathways
sxo01110  Biosynthesis of secondary metabolites
sxo01120  Microbial metabolism in diverse environments
sxo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sxo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SXYL_00811
   00053 Ascorbate and aldarate metabolism
    SXYL_00811
   00620 Pyruvate metabolism
    SXYL_00811
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SXYL_00811
   00561 Glycerolipid metabolism
    SXYL_00811
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SXYL_00811
   00310 Lysine degradation
    SXYL_00811
   00330 Arginine and proline metabolism
    SXYL_00811
   00340 Histidine metabolism
    SXYL_00811
   00380 Tryptophan metabolism
    SXYL_00811
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SXYL_00811
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SXYL_00811
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SXYL_00811
Enzymes [BR:sxo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SXYL_00811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra
Motif
Other DBs
NCBI-ProteinID: CEF18232
LinkDB All DBs
Position
Chr1:867904..869331
Genome map
AA seq 475 aa AA seqDB search
MRNFTKQYINGEWVESASGETIEVINPATEEVAGTIAKGNKEDVDKAVDAAENVYFEFRH
SSVQERRELLDKIVQEYKNRKEDIIEAITDELGAPLDVSENVHYRMGLDHFEAARDALDN
FEFEERRGDDLVVKEAIGVAGLITPWNFPTNQTSLKLSAAFAAGSPVVLKPSEETPFAAI
ILAEIFDKVGVPKGVFNLVNGDGQGVGNPLSEHPKVRMMSFTGSGPTGSSIMKKAADDFK
KVSLELGGKSPYIILDDVDIDKAASAATGKVVTNTGQVCTAGTRTLVPESIKEEFLTAVK
EQFSQVKVGDPRAEGTEVGPIISKKQFDQVQSYIDKGVEEGAELFYGGPGKPEGLDKGYF
ARPTIFNNVDNDMTIAREEIFGPVMSIITYNDVDEAIKIANDTEYGLAAYVYGKDQDTLH
KVARSLEAGTVEINEAGRKPDLPFGGYKQSGIGREWGDYGIEEFLEVKSIAGYYK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttcactaaacaatatatcaacggtgaatgggttgaaagtgcaagtggcgaa
acgatagaagtcatcaatccagcaacagaagaagtagcgggcacaatcgcgaaaggtaac
aaagaagatgttgataaagcagtggatgcagcagagaatgtatattttgaatttagacac
agttcagttcaagaaagaagagaactattagataaaattgttcaagagtataaaaataga
aaagaagatattatagaagctattactgatgaactaggtgcgccattagacgtatcggaa
aatgtccattatcgaatgggactagatcactttgaagcagcacgtgatgcattagataat
tttgaatttgaagagcgccgtggcgatgatttagttgtcaaagaagcaattggtgtagct
ggtttaatcacaccttggaacttccctacaaaccaaacgtctcttaaattatcagcagca
tttgcagcaggaagtccggtagttttaaaaccatcggaagaaactccatttgcagcaatt
attttagctgaaatttttgataaagtaggcgtgccaaaaggtgtgtttaacttagtcaat
ggtgatggtcaaggcgtagggaatcctttaagtgaacatcctaaagttagaatgatgtca
tttactggctctggcccaactggctcaagtattatgaagaaagccgcggatgattttaaa
aaagtatcacttgaactaggtggtaaatcaccatatattatcttagatgatgtagatata
gataaagcagcaagtgcagcaactggtaaagttgttacaaatactggtcaagtatgtaca
gcgggtactagaacacttgtacctgaaagtattaaagaagagttcttaacagctgtaaaa
gagcaatttagccaagttaaagtaggagacccacgtgcagaaggcacagaagttggacct
atcattagtaaaaaacaatttgatcaagtgcaatcatatattgataaaggcgtagaagag
ggtgcagaattattttacggtggccctggtaaaccagaaggtctggacaaaggatacttt
gcacgtccaacaatctttaacaatgtagataatgatatgacgatcgctcgagaagaaata
tttggtcctgttatgtcaattatcacttataacgatgtagacgaagctattaaaatcgca
aatgacacagaatatggtttagctgcatatgtatatggtaaagatcaagataccttacac
aaggtagcgcgttcattagaagctggtacagttgaaattaatgaagcaggacgcaaacca
gatttaccattcggtggctacaaacaatcaggtattggccgtgaatggggagactatggt
attgaagaattcctagaagttaaatctattgcaggttactataaataa

DBGET integrated database retrieval system