KEGG   Staphylococcus xylosus C2a: SXYL_00849Help
Entry
SXYL_00849        CDS       T03742                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sxo  Staphylococcus xylosus C2a
Pathway
sxo00473  D-Alanine metabolism
sxo00550  Peptidoglycan biosynthesis
sxo01100  Metabolic pathways
sxo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sxo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SXYL_00849 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SXYL_00849 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SXYL_00849 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sxo01011]
    SXYL_00849 (ddl)
Enzymes [BR:sxo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SXYL_00849 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:sxo01011]
 Precursor biosynthesis
  Amino acid ligase
   SXYL_00849 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: CEF18270
LinkDB All DBs
Position
Chr1:900318..901388
Genome map
AA seq 356 aa AA seqDB search
MAKENVCIVYGGKSAEHDVSILTAQNVLNAIDKAQYQVDIIYITNDGAWKKKENIVDTIN
DIDTLRLTEVEAGEISQLLNVGSTGNPYSAVFPVLHGPNGEDGTIQGLFEVLDIPYVGNG
VLAASSSMDKLVMKQLFAHRGLPQLPYVSFLRSEYHKYEGNILKLVHDKLEYPVFVKPAN
LGSSVGISKCNNEEELKVGIEEAFQFDRKLVIEQGIDAREIEVAVLGNDYPETTWPGEVV
KDVAFYDYKSKYKDGKISLEIPADLDEEVQMTLRNMAIEAFKATDCSGLLRADFFVTEDN
QIFINETNAMPGFTAFSMYPSLWENMGVSYADLIKKLIELAKEKHNDKKQNKYKID
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaatgtatgtatcgtatacggaggaaaaagtgcagaacacgatgtttca
atattaacagcacaaaatgttttgaatgctattgataaagcacaatatcaagtagacatt
atttacataacaaatgatggtgcgtggaaaaagaaagaaaatatcgtagacactataaat
gatatagacactttacgtttaacagaagttgaagcaggagaaatttcacagttgcttaac
gtaggtagtactggaaatccttatagtgcagttttccctgtattgcatgggccaaatggt
gaggatggtacaatacaaggtttatttgaagtattggatataccatatgtagggaatggc
gttttagctgcctcaagctcaatggataaattagtaatgaaacaactttttgcacataga
ggcttacctcaattaccatatgtgagttttttaagaagtgagtatcataaatatgaaggt
aatatattaaaattggtacatgataaattagaatatccagtatttgttaaaccagctaac
ttaggatcaagtgtaggaattagtaaatgtaataatgaagaagaattaaaagttggtatt
gaagaagcatttcagtttgaccgtaagttagttattgaacaaggtattgatgctagagaa
attgaagttgctgtattaggcaatgattatccggaaacaacttggcccggagaagtcgtt
aaagacgtcgctttctatgattacaaatcaaaatacaaagatggaaagattagtttagaa
attccagctgacttagatgaagaagttcaaatgactttaagaaatatggcgatcgaagca
tttaaagcaactgactgctctggcttattacgtgccgatttctttgttactgaagataat
caaatttttataaatgagacaaacgctatgccaggatttactgcgtttagtatgtatcct
agtctttgggaaaatatgggtgtatcatatgcagatttaattaaaaaattaattgaatta
gctaaagaaaaacacaatgataaaaagcaaaataaatacaaaattgattga

DBGET integrated database retrieval system