KEGG   Staphylococcus xylosus C2a: SXYL_01921Help
Entry
SXYL_01921        CDS       T03742                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADPH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sxo  Staphylococcus xylosus C2a
Pathway
sxo00061  Fatty acid biosynthesis
sxo00780  Biotin metabolism
sxo01100  Metabolic pathways
sxo01130  Biosynthesis of antibiotics
sxo01212  Fatty acid metabolism
Module
sxo_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sxo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SXYL_01921 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SXYL_01921 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SXYL_01921 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sxo01004]
    SXYL_01921 (fabI)
Enzymes [BR:sxo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SXYL_01921 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SXYL_01921 (fabI)
Lipid biosynthesis proteins [BR:sxo01004]
 Fatty acid synthase
  Component type
   SXYL_01921 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR HP0268 PALP 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CEF19302
UniProt: A7KJG9
LinkDB All DBs
Position
Chr1:complement(1968985..1969755)
Genome map
AA seq 256 aa AA seqDB search
MLNLENKTFVIMGIANKRSIGFGVAKVLDQLGAKLVFTYRKDRSKKELEKLVEQLNQETH
HMYQIDVQSDEDVVNGFAEIGKEVGNIDGVYHSIAFANMEDLRGRFIDTSRDGFLLAQDI
SSYSLTLVSREAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVRYLALDLGQ
ENIRVNAISAGPIRTLSAKGVGGFNSILNEISERAPLKRNVDQEEVGKTAAYLLSDFSSG
VTGENIHVDSGYHIVK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatttagaaaacaaaactttcgtcattatgggtattgcaaacaaacgtagtatt
ggttttggcgttgctaaagtattggaccaacttggtgcaaaattagtatttacataccgt
aaagaccgtagtaaaaaagaattagaaaaattagttgaacaattaaatcaagaaacacat
catatgtatcaaattgatgtacaaagtgatgaagatgtagtaaatggttttgctgaaatt
ggaaaagaagttggcaacatagatggggtttaccattcgatagcatttgcaaatatggaa
gatttacgtggtcgctttattgatacatcaagagatggcttcttattagcacaagatata
agttcttattcattaacacttgtatcacgtgaagctaaaaaacttatgcctgaaggtggt
agtattgtagctacaacttacttaggtggcgaattcgcagttcaaaattataatgtaatg
ggtgttgcaaaagcaagtttagaggcaaatgttcgttatttagcattagatttaggacaa
gaaaatattcgtgtaaacgcgatttcagctggacctatccgtacattgagtgcaaaaggt
gtgggtggatttaattccattttaaatgaaatctcagaacgtgcaccgttaaaacgtaat
gtcgatcaagaagaagttggtaaaactgcagcttatctattaagtgatttttcaagtggt
gttaccggagaaaatattcatgtagacagcggttatcatatcgttaaataa

DBGET integrated database retrieval system