KEGG   Staphylococcus xylosus C2a: SXYL_02469Help
Entry
SXYL_02469        CDS       T03742                                 

Gene name
ilvD2
Definition
(GenBank) Dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
sxo  Staphylococcus xylosus C2a
Pathway
sxo00290  Valine, leucine and isoleucine biosynthesis
sxo00770  Pantothenate and CoA biosynthesis
sxo01100  Metabolic pathways
sxo01110  Biosynthesis of secondary metabolites
sxo01130  Biosynthesis of antibiotics
sxo01210  2-Oxocarboxylic acid metabolism
sxo01230  Biosynthesis of amino acids
Module
sxo_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sxo_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sxo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SXYL_02469 (ilvD2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SXYL_02469 (ilvD2)
Enzymes [BR:sxo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     SXYL_02469 (ilvD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: CEF19839
LinkDB All DBs
Position
Chr1:2525181..2526881
Genome map
AA seq 566 aa AA seqDB search
MAKDQEQQTNQQDLRIRSKVISEGVSRTPNRAYLRALGFEDEDFQKPMIGVASTWSEVTP
CNMHIDGLARASKQGISEAGGSPLIFNTITVSDGISMGTDGMRFSLPSREIIADSIEAVV
SAENLDGVVAIGGCDKNMPGCMIGIARLNLPAVFVYGGTILPGKLDGKDLDAVSAFEGVG
QYNNGEIDKEALHKVECSACPGAGACGGMFTANTMSSAIEAMGMSLPGSASHPAVSTNKA
KDSRAAGKAVYKLLEKGIYPKDIMTKEAFENAITVVMALGGSTNAILHLLAIAHTIEVDL
TLDDFERIRKRVPHIADLRPSGKYVMAHLDEVGGIPAVMKLLHDKGLIHGDCLTVTGHTV
AENLADQPDLTDNKKIINFEEPKHATGPLVILKGNLAPEGAVAKISGLSVTYIKGPARVF
DSEAKATKAILNDEIKPGDVVVIRYAGPKGAPGMPEMLSASSILVGKGLGESVALLTDGR
FSGGSHGLVIGHAAPESQVGGPMALLEENDTVTIDAEKLEISFDVSEEELERRYQNWQVP
PLKATKGTLTKYAKLVSSASKGAITD
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaagatcaagaacaacaaacaaatcaacaagatttacgtatacgaagtaaagta
attagtgaaggcgtcagtagaacgccaaatcgcgcttatttacgagcgctcggtttcgag
gatgaagattttcaaaaacctatgattggggttgcaagtacttggagtgaagttacacca
tgtaacatgcatattgatggtctagcacgtgcatctaaacaaggcatcagtgaagcaggt
ggttctcctttaattttcaatactattacagtttcagacggtatatctatggggacagac
ggtatgcgcttttcattaccaagtcgtgaaatcattgcagattccatagaagcggttgtt
agtgccgaaaaccttgatggcgttgtggctataggtggctgtgataagaacatgcctggt
tgtatgattggaatcgctcgtttgaatttacctgccgtattcgtttatggtggaacgatt
ttacccggaaaattagatggcaaagatttagatgccgtatctgcatttgaaggcgtagga
cagtataataatggagaaattgataaagaggctttacataaagtagagtgttctgcatgc
ccaggtgctggcgcttgtggtggtatgtttacagctaacacgatgtcatcagcaattgaa
gcaatgggtatgagtttaccaggtagtgcttcacatcctgctgtttctacgaataaagca
aaagatagcagggcagcaggaaaagcagtttataaattattagaaaaaggtatttatcca
aaagacatcatgactaaagaggcctttgaaaacgcaattactgttgtaatggcgttaggt
ggttcaacaaatgctattttacacctacttgcgattgcacataccatcgaagtagattta
acactagatgattttgagagaatccgtaagcgtgtacctcatattgccgatctgagacca
agtggtaagtatgtaatggcacaccttgacgaagtaggtggtatccctgctgtgatgaaa
cttcttcatgacaaaggattaatccatggtgattgcttaactgtaacaggtcatacagta
gctgaaaatttagctgaccaaccagacctaactgataataaaaaaatcataaatttcgaa
gaacctaaacacgcaactggtccccttgttattttaaaaggtaacttagctcctgaaggg
gctgtagctaaaatctctggtcttagtgttacttatatcaaaggccctgcacgtgtcttc
gattcagaagcgaaagccactaaagctatactaaatgatgaaatcaaacctggagatgtc
gtagttattcgctatgcaggacctaaaggcgcaccaggcatgcctgaaatgttgtctgca
tcctctatccttgtaggaaaagggttaggagaatcagtagcattgcttacagatggtaga
ttctctggtggttcacatggactagtcataggtcacgctgcaccagaatctcaagtcggc
ggaccaatggcactcttagaagaaaacgatacagttacgattgatgcagagaaacttgaa
attagtttcgatgtttccgaagaagagcttgaacgtcgttatcaaaattggcaagtccct
cctctaaaagcaacaaaaggaacactcactaagtatgctaaacttgtctcttcagcatca
aaaggcgcaattactgactaa

DBGET integrated database retrieval system