KEGG   Staphylococcus xylosus C2a: SXYL_02535Help
Entry
SXYL_02535        CDS       T03742                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sxo  Staphylococcus xylosus C2a
Brite
KEGG Orthology (KO) [BR:sxo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SXYL_02535 (ahpF)
Enzymes [BR:sxo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SXYL_02535 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 HI0933_like Thi4 GIDA DAO FAD_oxidored FAD_binding_3 NAD_binding_8 AlaDh_PNT_C K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: CEF19905
UniProt: A0A5R9B4Y6
LinkDB All DBs
Position
Chr1:2595850..2597373
Genome map
AA seq 507 aa AA seqDB search
MLNDQLKSQLQQLLQLMEGDVVLKASLGADDKSNELKELLDEVSAASSHITIEETDLKRT
PSFSVNRPGEETGITFAGLPMGHEFNSLVLALLQVSGRAPKEEQAVIDQIKALDKPLHFE
TYISLTCQKCPDVVQALNLMSLLNPNITHSMIDGAIFREESENIMAVPAVFLDGEEFGNG
RMTVQDILANLGSQADPAEFNDKDPYDVLIVGGGPASGSAAVYTARKGLRTGIVADRIGG
QVNDTATIENFVTVKETDGPKFASALEDHIKQYDIDVMTGIRANEIEKTDSGIVVSLENG
AKLTSKTVIISTGARWRKLEVPGEEALINKGVAFCPHCDGPLFENKNVAVVGGGNSGVEA
AIDLAGIVEHVTLLERNASLKADNVLQERLNSLPNVTVIKNAQTTEVLGENAVTGIKYQD
KSLGEEHTLELEGIFVQIGLLPNTEWLNNYVELNEANEIMIDRKNATSIPGIFAAGDVTD
DRNKQIIISMGSGANAALNAFDYIIRH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatgatcagcttaaatcacaattacaacaattacttcaattaatggaaggcgat
gttgtattaaaagcaagtcttggtgctgatgacaagtctaacgaacttaaagagttatta
gacgaagtctctgcagcttcttctcacattactatagaagaaactgacttaaaacgcaca
ccaagtttctcagtaaatagacctggagaagaaaccggcattacttttgccggtttacct
atgggtcacgaattcaattcacttgtacttgcattattacaagtaagtggacgcgcacct
aaagaagaacaagccgtaatagaccaaatcaaagcattagataaaccactacactttgaa
acgtatattagtttaacttgtcaaaaatgccctgacgttgttcaagcattaaacttaatg
agtttattaaaccctaatatcacgcattcaatgattgacggtgctatctttagagaagaa
tctgaaaatattatggcagtacctgcagtattcttagatggcgaagaatttggtaatggg
cgtatgacagttcaagatatcctagcaaatttaggcagccaagcagacccagcagagttc
aatgataaagatccatatgacgtgttaatcgttggtggtggacctgcaagtggtagtgct
gctgtttatacagcacgtaaaggtctgcgtacaggaattgttgctgatcgtattggcgga
caagttaatgatacagcaactattgaaaactttgtcactgttaaagaaacagatggccca
aaatttgcctcagcattagaagatcatataaagcaatatgacatcgatgtaatgacaggc
attcgtgctaatgaaattgaaaaaactgatagtggtatcgttgtttcgcttgaaaatggc
gcaaaattaacaagtaaaacagttattatttcaacaggtgcacgttggcgcaagcttgaa
gtacctggcgaagaggcattgattaacaaaggcgttgcattctgtccacattgtgacgga
cctttatttgaaaataaaaacgtagccgtagtcggtggcggtaattcaggtgtcgaagca
gcaattgatttagcaggtatcgttgaacacgtcacactattagaacgtaatgctagcctt
aaagcagacaacgttttacaagaacgtttaaacagcttacctaacgtaactgttattaaa
aatgcacaaacaactgaagtacttggtgaaaatgctgtaactggtattaaataccaagac
aaatctctaggcgaagaacatacactagaacttgaaggtattttcgttcaaatcggacta
ttaccaaatactgaatggcttaataattatgttgaattaaatgaagctaatgagattatg
attgatcgtaagaacgctacaagcatcccaggtatttttgcagctggtgatgttactgac
gatcgtaataaacaaattattatctcaatgggctctggtgcaaatgctgcattaaatgcc
tttgattatatcattagacattaa

DBGET integrated database retrieval system