KEGG   Staphylococcus xylosus HKUOPL8: BE24_03035Help
Entry
BE24_03035        CDS       T03248                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sxy  Staphylococcus xylosus HKUOPL8
Pathway
sxy00020  Citrate cycle (TCA cycle)
sxy00190  Oxidative phosphorylation
sxy00650  Butanoate metabolism
sxy01100  Metabolic pathways
sxy01110  Biosynthesis of secondary metabolites
sxy01120  Microbial metabolism in diverse environments
sxy01130  Biosynthesis of antibiotics
sxy01200  Carbon metabolism
Module
sxy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sxy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BE24_03035 (sdhA)
   00650 Butanoate metabolism
    BE24_03035 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BE24_03035 (sdhA)
Enzymes [BR:sxy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BE24_03035 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BE24_03035 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C HSDR_N NAD_binding_8 Slx4
Motif
Other DBs
NCBI-ProteinID: AID01100
LinkDB All DBs
Position
615196..616959
Genome map
AA seq 587 aa AA seqDB search
MAEKKIIVVGGGLAGLMSTIKAAEQGAHVDLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPSVHLDDTVYGGDFLANQPPVKAMTDAAPKIIHLLDRMGVMFNRTKEGLLDFRRFGGTM
YHRTAYAGATTGQQLLYALDEQVRSFEVDGLVTKYEGWEFLGIVKDDDNMARGIVAQDMT
TAEIQSFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAMYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPHELDIKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
DYDQMTNIKGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAVDYISNIEDSYTDL
DESIYEKHVKDQQEKFDQLLNMKGTENAYKLHRELGEIMTANVTVVRENKSLLETDKKIV
ELMERYQNIDIEDTQTWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
NDEEWLKTTLATYQGKTEAPKFTYEPVDISLIPPRKRDYSKASKGGK
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagaaaattattgttgtcggtggtggactagctggtctaatgtcaacaatt
aaagcagcagaacagggtgcgcatgtagacctgttctcacttgttcctgttaaacgttca
cactctgtttgtgcacaaggtggcattaatggagcggtaaatacgaaaggtgaaggagat
tctccgtcagtgcatttagatgatactgtttatggtggagacttcttagcaaaccaacca
cctgtaaaagcaatgactgatgcagcacctaaaattattcatttacttgatcgtatgggc
gtaatgtttaatagaactaaagaaggactattagactttagacgttttggtggtactatg
tatcaccgaactgcatatgccggtgctactacaggtcaacaattactctatgcattggac
gaacaagtgcgtagctttgaggttgacggattagttacaaaatacgaaggctgggaattc
ttaggtatagttaaagatgacgataatatggcaagaggtatcgttgctcaagatatgaca
actgctgaaattcaatcatttggttcagacgctgtgattatggcgactggtggtcctggt
attatctttggtaaaacaacaaattcaatgattaatacaggttcagctgcttcaattgta
taccaacaaggtgcaatgtacgctaatggtgaatttattcaaattcatccaactgctatc
cctggcgatgataaacttagattaatgagtgaatcagcacgtggtgaaggtggtcgtatc
tggacatataaagatggtaagccatggtacttcttagaagaaaaatacccagattatggt
aacttagttccgcgtgatatcgcgacacgtgaaatttttgatgtatgtgtgaatcaaaaa
ttaggtatcaacggtgaaaacatggtatatctcgatttatcacataaagatccacatgaa
ctggatattaaattaggtggtatcattgagatttatgaaaaattcactggtgatgaccct
cgtaaagtaccaatgaaaatcttcccagcagtacattactcaatgggtggtttatacgta
gattatgatcaaatgacaaatattaaaggtttatttgcagcaggcgaatgtgatttttca
caacatggtggtaatcgcttaggggctaactctttactatcagcaatttatggtggtact
gttgctggtccaaatgcagtagattatatttcaaatattgaagattcatatacagattta
gatgagagcatttacgaaaaacacgttaaagatcaacaagaaaaatttgatcaactatta
aatatgaagggcactgaaaatgcctataaacttcatagagaattaggggaaatcatgact
gcaaatgttacagttgtgcgtgaaaataaatctttattagaaacagacaagaaaattgta
gaattgatggaacgttatcaaaatattgatattgaagatactcaaacttggagtaaccaa
gccgtattctttacacgtcaactatggaatatgttagtacttgcacgtgtaatcacaatt
ggtgcatacaatagaaatgaatctcgtggcgcacattataaaccagaattcccagaaaga
aacgatgaagaatggttaaaaacaacattagctacgtatcaaggcaaaacagaagcacct
aagtttacttacgaaccagttgatattagtttaataccaccacgtaaacgtgattactct
aaggcgtcaaagggaggtaaataa

DBGET integrated database retrieval system