KEGG   Staphylococcus xylosus HKUOPL8: BE24_03040Help
Entry
BE24_03040        CDS       T03248                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sxy  Staphylococcus xylosus HKUOPL8
Pathway
sxy00020  Citrate cycle (TCA cycle)
sxy00190  Oxidative phosphorylation
sxy00650  Butanoate metabolism
sxy01100  Metabolic pathways
sxy01110  Biosynthesis of secondary metabolites
sxy01120  Microbial metabolism in diverse environments
sxy01130  Biosynthesis of antibiotics
sxy01200  Carbon metabolism
Module
sxy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sxy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BE24_03040 (sdhB)
   00650 Butanoate metabolism
    BE24_03040 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BE24_03040 (sdhB)
Enzymes [BR:sxy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BE24_03040 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BE24_03040 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_17 Fer4_2 Fer4 Fer4_16 Fer4_13 Fer4_15 Fer4_21 Fer4_18 Fer4_6 Fer4_4 Lectin_leg-like
Motif
Other DBs
NCBI-ProteinID: AID01101
LinkDB All DBs
Position
616962..617774
Genome map
AA seq 270 aa AA seqDB search
MVETKEVNETPAQNEQPSQKTIKLIIKRQDNDKSTPYNEEFEIPYRENLNVIACLMEIRR
NPVNSKGEKTTPVIWDMNCLEEVCGACSMVINGQARQSCSAIVDQLEQPIKLEPMNTFPV
IRDLQVDRTRMFDNLKRMKAWVPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEVC
PNVTSKNDFVGAQAISQVRLFNLHPTGSMTKDERLEALMGGGGLQECGNSQNCVNACPKG
IPLTTSIAALNRETSFHMFKSFFGSDHQVH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaacaaaagaagttaatgaaactcctgcacaaaacgagcaacctagccaaaaa
acaattaaattaattataaaacgtcaagacaatgacaaatcaacaccatataatgaagaa
tttgaaattccttatagagagaatctaaatgttattgcatgtttaatggaaatcagaaga
aacccagttaatagtaaaggtgaaaaaacaacacctgttatttgggatatgaactgttta
gaagaagtttgtggtgcatgttcaatggtaattaatggacaagcaagacaatcttgttct
gcaattgttgaccaattagaacaacctattaaattagaaccaatgaatacattcccagtt
attcgtgatttacaagtagatcgaacaagaatgttcgataacttgaaacgaatgaaagca
tgggttccaattgatggtacgtatgatttaggtccaggtccacgtatgcctgagaaaaaa
cgtcaaactgcttatgaactttctaaatgtatgacatgtggtgtttgtttagaagtttgt
ccaaatgtaactagtaaaaatgactttgttggtgcccaagcaatttcacaagttagacta
tttaacttacatccaacaggttcaatgacaaaagacgaacgcttggaagcattaatgggt
ggcggaggtttacaagaatgtggtaactctcaaaactgtgtaaatgcatgtccaaaaggg
ataccattgactacatctattgctgcattaaatagagaaacatcattccatatgttcaaa
tcattctttggttcagatcatcaagtacattaa

DBGET integrated database retrieval system