KEGG   Staphylococcus xylosus HKUOPL8: BE24_07410Help
Entry
BE24_07410        CDS       T03248                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sxy  Staphylococcus xylosus HKUOPL8
Pathway
sxy00970  Aminoacyl-tRNA biosynthesis
sxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sxy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BE24_07410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sxy03029]
    BE24_07410
Enzymes [BR:sxy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BE24_07410
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BE24_07410
Mitochondrial biogenesis [BR:sxy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BE24_07410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey MOZART1 YqeY
Motif
Other DBs
NCBI-ProteinID: AID01862
LinkDB All DBs
Position
complement(1463757..1465184)
Genome map
AA seq 475 aa AA seqDB search
MHFETVIGLEVHVELKTDSKMFSSSPAHFGAKPNSNTNVIDLAYPGVLPVVNKRAVDWAM
RASMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETKRIGITR
LHMEEDAGKSTHKDGYSLVDLNRQGTPLIEIVSEPDIRSPQEAYAYLEKLRSIIQYTGVS
DCKMEEGSLRCDANISLRPYGQEEFGTKAELKNLNSFTYVRKGLEYEEKRQEEELLNGGE
ILQETRRFDESNGKTLLMRVKEGSDDYRYFPEPDIVPLYVDDEWKERVRQTIPELPDERK
EKYVKQFGLPAYDAHVLTLTKEMSDFFEGAVAQGADVKLTSNWLMGGVNEYLNKNQIELL
DTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAENGGDAKQIMEDKGLVQISDEATLLK
FVNEALDNNEQSIEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELDKR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcattttgaaacagttattgggctagaagtccatgttgagttgaaaacagattctaaa
atgttctcatcatcaccagcgcattttggagcgaaaccaaactcaaatacaaatgtaatt
gaccttgcatatcctggtgtcttgccagtagtaaataaacgtgcagttgattgggctatg
agagcatcaatggcattaaatatggaaattgctacggaatcaaaatttgaccgtaaaaac
tatttctatccagataatccaaaagcatatcaaatatcacagtttgaccaaccaattggt
gaaaatggttatattgatatcgaggttgatggagagacaaaacgtattggtatcacacgt
ttacacatggaagaagatgctggtaaatcaacacataaagatggctattctttagttgat
ttaaatagacaaggtacgccattaattgaaatcgtatctgaaccagacattcgttctcca
caagaagcgtatgcatacttagaaaaattacgttctattattcaatatacaggcgtttct
gattgtaaaatggaagaaggctcactacgttgtgatgctaatatttctttacgcccatat
ggtcaagaagaatttggtacaaaagcagaacttaaaaacttaaattcattcacttatgtt
cgtaaaggactagaatatgaagaaaaacgccaagaagaagaattgttaaacggtggggaa
attcttcaagaaacacgtagatttgatgaatctaatggtaaaacattattaatgcgtgtt
aaagaaggttctgacgactatcgttacttcccggaaccagatatcgttcctctatacgtt
gatgatgagtggaaagaacgagttcgtcaaacaatcccagaactaccagatgaaagaaaa
gagaaatatgttaagcaatttggtttaccagcttatgatgcacatgtacttacacttact
aaagaaatgtcagatttcttcgaaggtgctgtagcacaaggtgctgacgtcaaattaaca
tctaactggttaatgggcggagtaaacgagtatttaaataaaaaccaaattgaattatta
gatactaaacttacacccgaaaacttagctggaatgattaaattaatcgaagacggaaca
atgagtagtaaaattgctaaaaaagtattcccagaacttgccgaaaatggtggggatgcc
aagcaaattatggaagataagggcttagttcaaatctcggatgaggcaacacttcttaag
tttgttaatgaagcattagataataacgaacaatcaattgaagactataaaaatggtaaa
ggtaaagcgatgggcttcttagttggacaaattatgaaagcttcaaaaggccaagctaat
ccacaattagtcaaccaattattgaaacaagaactagataaaagataa

DBGET integrated database retrieval system