KEGG   Staphylococcus xylosus HKUOPL8: BE24_13230Help
Entry
BE24_13230        CDS       T03248                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sxy  Staphylococcus xylosus HKUOPL8
Brite
KEGG Orthology (KO) [BR:sxy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BE24_13230
Enzymes [BR:sxy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BE24_13230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like FAD_binding_2 Thi4 GIDA DAO FAD_oxidored FAD_binding_3 NAD_binding_8 AlaDh_PNT_C K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AID02893
LinkDB All DBs
Position
complement(2720743..2722266)
Genome map
AA seq 507 aa AA seqDB search
MLNDQLKSQLQQLLQLMEGDVVLKASLGADDKSNELKELLDEVSAASSHITIEETDLKRT
PSFSVNRPGEETGITFAGLPMGHEFNSLVLALLQVSGRAPKEEQAVIDQIKALDKPLHFE
TYISLTCQKCPDVVQALNLMSLLNPNITHSMIDGAIFREESENIMAVPAVFLDGEEFGNG
RMTVQDILVNLGSQADPAEFNDKDPYDVLIVGGGPASGSAAVYTARKGLRTGIVADRIGG
QVNDTATIENFVTVKETDGPKFASALEDHIKQYDIDVMTGIRANEIEKTDSGIVVSLENG
AKLTSKTVIISTGARWRKLEVPGEEALINKGVAFCPHCDGPLFENKNVAVVGGGNSGVEA
AIDLAGIVEHVTLLERNASLKADNVLQERLNSLPNVTVIKNAQTTEVLGENAVTGIKYQD
KSLGEEHTLQLEGIFVQIGLLPNTEWLNNYVELNEANEIMIDRKNATSIPGIFAAGDVTD
DRNKQIIISMGSGANAALNAFDYIIRH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatgatcagcttaaatcacaattacaacaattacttcaattaatggaaggcgat
gttgtattaaaagcaagtcttggtgctgatgacaagtctaacgaacttaaagagttatta
gacgaagtctctgcagcttcttctcacattactatagaagaaactgacttaaaacgcaca
ccaagtttctcagtaaatagacctggagaagaaaccggcattacttttgccggtttacct
atgggtcacgaattcaattcacttgtacttgcattattacaagtaagtggacgcgcacct
aaagaagaacaagccgtaatagaccaaatcaaagcattagataaaccactacactttgaa
acgtatattagtttaacttgtcaaaaatgccctgacgttgttcaagcattaaacttaatg
agtttattaaatcctaatatcacgcattcaatgattgacggtgctatctttagagaagaa
tctgaaaatattatggcagtacctgcagtattcttagatggcgaagaatttggtaatggg
cgtatgacagttcaagatatccttgtaaatttaggcagccaagcagacccagcagagttc
aatgataaagatccatatgacgtgttaatcgttggtggtggacctgcaagtggtagtgct
gctgtttatacagcacgtaaaggtctgcgtacagggattgttgctgatcgtattggcgga
caagttaatgatacagcaactattgaaaactttgtcactgttaaagaaacagatggtcca
aaatttgcctcagcattagaagatcatataaagcaatatgacatcgatgtaatgacaggc
attcgtgctaatgaaattgaaaaaactgatagtggtatcgttgtttcgcttgaaaatggc
gcaaaattaacaagtaaaacagttatcatttcaacaggtgcacgttggcgcaagcttgaa
gtacctggcgaagaggcattgattaacaaaggcgttgcattctgtccacattgtgacgga
cctttatttgaaaataaaaacgtagccgtagtcggtggcggtaattcaggtgtcgaagca
gcaattgatttagcaggtatcgttgaacacgtcacactattagaacgtaatgctagcctt
aaagcagacaacgttttacaagaacgtttaaacagcttacctaacgtaactgttattaaa
aatgcacaaacaactgaagtacttggtgaaaatgctgtaactggtattaaataccaagac
aaatctctaggcgaagaacatacactacaacttgaaggtattttcgttcaaatcggacta
ttaccaaatactgaatggcttaataattatgttgaactaaatgaagctaatgagattatg
attgatcgtaagaacgctacaagcatccctggtatttttgcagctggtgatgttactgac
gatcgtaataaacaaattattatctcaatgggctctggtgcaaatgctgcattaaatgcc
tttgattatatcattagacattaa

DBGET integrated database retrieval system