KEGG   Sphingobium yanoikuyae: A6768_01030Help
Entry
A6768_01030       CDS       T05170                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sya  Sphingobium yanoikuyae
Brite
KEGG Orthology (KO) [BR:sya00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A6768_01030
Enzymes [BR:sya01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A6768_01030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored AlaDh_PNT_C FAD_binding_3 NAD_binding_7 FAD_binding_2 Glutaredoxin NAD_binding_8 DAO FMO-like K_oxygenase Peripla_BP_2 HTH_43 Thi4
Motif
Other DBs
NCBI-ProteinID: ATI78711
UniProt: A0A291MUP3
LinkDB All DBs
Position
complement(216339..217919)
Genome map
AA seq 526 aa AA seqDB search
MLDANLKGQLKAYLANITQPIELVASLDDGAKSREMNELLTEIAELSDKVSLATGSDKRK
PSFMIRRVGTDIGVTFAGLPMGHEFTSLVLALLQVGGHPSKAAQDVIQQVKDLDGDFAFE
TYFSLSCQNCPDVVQALNLMSVLNPRISHVAIDGGLFKDEVDARKVMAVPTIFLNGEPFG
QGRMELEQIVAKIDSGAEAKAAEKIRKQDPFEVLVVGGGPAGAAAAIYSARKGIRTGVAA
ERFGGQVLDTMDIENFISVSRTEGPKLASALEAHVKDYDVEIMNLQKAAKLIPAKTEGGY
HEVVLENGASLKGRTIILSTGARWRQMGVPGEDEYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLASLPNVKIITSALTTKVNGNGE
RVSGLSYKDRNSGTEHDVELEGIFVQIGLVPNTEWLKDTISLSPRGEIEIDARGETSQPG
IFAAGDCTTVPYKQIVIAMGAGSTAALSAFDYLIRLPTAEEAAEAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcaaatctcaaggggcagttgaaggcctatctggcgaacatcacccagccg
atcgagctggtggcttcgctggatgatggcgccaagtcgcgcgaaatgaacgaattgctg
accgaaatcgccgagctttcggacaaggtcagcctcgccaccggatcggataagcgcaag
cccagcttcatgatccgccgcgtcggcaccgatatcggtgtgaccttcgccggcctgccg
atgggccatgaattcacctcgctggtgctcgccttgctgcaggtcggcggtcatccgtcc
aaggccgcgcaggacgtcatccagcaggtcaaggatctggacggcgacttcgccttcgaa
acctatttctcgctgtcgtgccagaactgccccgacgtggtgcaggcgctgaacctgatg
agcgtcttgaacccccggatcagccatgtcgcgatcgacggcggcctgttcaaggatgag
gtcgacgctcgcaaggtcatggcggtgccgaccatcttcctcaacggcgaacccttcggc
cagggccggatggagctggagcagatcgtcgccaagatcgacagtggcgccgaggcgaag
gcggccgagaagatccgcaagcaggatcccttcgaggtgctggtggtcggcggcggccct
gccggcgcggcggcggccatctattcggcgcgcaaaggcatccgcaccggcgtggcggcg
gaacgcttcggcggccaggtgctcgacaccatggatatcgagaatttcatctcggtcagc
cgcaccgaaggccccaagctcgccagcgcgctggaagcgcacgtcaaggattatgacgtc
gagatcatgaacctgcagaaggcagcgaagctgatcccggccaagaccgaaggtggctat
catgaagtcgtgcttgaaaatggcgcgtcgctgaaaggccgcaccatcatcctgtcgacc
ggcgcccgctggcgccagatgggcgtccccggtgaggacgaatatcgcaacaagggcgtg
gcctactgcccgcactgcgatggtccgctgttcaagggcaagcgcgtggcggtgatcggc
ggcggcaatagcggcgtcgaagccgcgatcgacctggccggcatcgtcgcccatgtgacg
ctgatcgagtttgacagccagctccgcgccgacgcggtgctgcagcgcaagctcgccagc
ctgcccaacgtcaagatcatcacctcggccttgaccacaaaggtgaacggcaatggcgag
cgggtgagcggcctcagctataaggaccgcaacagcggcaccgagcatgatgtcgagctg
gagggcattttcgtccagatcggcctggtgcccaacaccgaatggctcaaggacacgatc
tcgctctcgccccgtggcgagatcgagatcgacgcgcgcggcgaaaccagccagcccggc
atcttcgctgccggcgactgcacaaccgtgccctacaagcagatcgtgatcgccatgggt
gcggggtcaaccgcagccctgtcggccttcgactatctgatccgtctgcccactgccgag
gaagcggccgaggcagcctga

DBGET integrated database retrieval system