KEGG   Sphingobium yanoikuyae: A6768_03180Help
Entry
A6768_03180       CDS       T05170                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sya  Sphingobium yanoikuyae
Pathway
sya00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sya00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A6768_03180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sya02000]
    A6768_03180
Enzymes [BR:sya01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A6768_03180
Transporters [BR:sya02000]
 Other Transporters
  Pores ion channels [TC:1]
   A6768_03180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ATI83120
UniProt: A0A291N7L4
LinkDB All DBs
Position
complement(673312..673941)
Genome map
AA seq 209 aa AA seqDB search
MADPVLLYTNPMSRGQIARWMLEEVGAPYEAVVLDYAGGMKTADYRAINPMGKVPAIVHG
GKVVTECAAICAYLADAFPAAGLAPGTDDRADYYRWLFFAAGPVEAAVTNKAMGFVLPEG
RERSAGYGSLDDTLDTLETAVTGRSWICGGTFTAADVYVGAQIDWGLTFGTIPSRPAFEA
YAARLRERPAYKRQKEIDNALIAEMQKQG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcggacccggttcttctctataccaaccccatgtcgcgcgggcagatcgcccgctgg
atgctggaggaggtcggcgccccctatgaggcggtggtgctggattatgccggcggcatg
aagaccgccgactatcgcgcgatcaacccgatgggcaaggtgccggcgatcgtccatggc
ggcaaggtggtgaccgaatgcgccgccatctgcgcctatctggccgacgccttccccgcc
gccggcctggcgccggggaccgatgaccgggccgactattatcgctggctcttcttcgcc
gccggtccggtggaggccgccgtcaccaacaaggcgatgggcttcgtcctgcccgaggga
cgcgagcgcagcgcgggctatggctcgctcgacgacacgctcgatacgctcgaaacggcg
gtcaccggccgcagctggatctgcgggggtaccttcaccgcggcggacgtctatgtcggc
gcgcagatcgactgggggctcaccttcggcaccatccccagccgcccggcgttcgaggcc
tatgccgcccgattgcgcgaacgcccggcctataagaggcagaaggagatcgacaacgcc
ctgatcgccgagatgcagaaacagggctga

DBGET integrated database retrieval system