KEGG   Sphingobium yanoikuyae: A6768_15005Help
Entry
A6768_15005       CDS       T05170                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sya  Sphingobium yanoikuyae
Pathway
sya00473  D-Alanine metabolism
sya00550  Peptidoglycan biosynthesis
sya01100  Metabolic pathways
sya01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sya00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A6768_15005
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A6768_15005
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A6768_15005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sya01011]
    A6768_15005
Enzymes [BR:sya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A6768_15005
Peptidoglycan biosynthesis and degradation proteins [BR:sya01011]
 Precursor biosynthesis
  Amino acid ligase
   A6768_15005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ATI81164
UniProt: A0A084ES10
LinkDB All DBs
Position
complement(3259238..3260194)
Genome map
AA seq 318 aa AA seqDB search
MSRGPWHVAVLMGGWSAERPVSLSSGEGVAKALESRGHRVTRIDMDRDVAARLTETKADV
VFNALHGVPGEDGTVQGMMDLMGLTYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGQIV
ASESLYAGDPLPRPYVLKPVNEGSSVGVAIVTAEGNYGNPIARDSVGPWQEFPELLAEPY
IRGRELTTAVLGDEALLVTELRPKSGFYDFDAKYTDGMTEHVCPAEIPDEITQACKAIAL
KAHQLLGCKGASRSDFRWDDSQGVEGLYLLEVNTQPGMTPLSLVPEQAKKLGIEYAELVE
RICEEALTRGPNMGAGNG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtggtccctggcatgtcgccgtattgatgggcggctggtcggcggagcggccg
gtgtcgctgtcgagcggcgagggcgttgccaaggcgctggaatcgcgcggccatcgggtc
acgcggatcgacatggatcgcgacgttgccgcgcgcctgactgagactaaggcggatgtg
gtgttcaacgcgctgcatggcgtgccgggcgaggatggcacggtgcagggcatgatggac
ctgatgggcctcacctacacccatagcggccttgccacttcggtcatcgcgatcgacaag
cagctgaccaagcaggcgctggtgccgcacggcatccccatgcccggtggccagatcgtg
gcgagcgagagcctgtacgccggcgatccgctgccgcgcccctatgttctgaagcccgtc
aatgagggcagctcggtcggcgtcgcgatcgtcacggccgagggcaattatggcaatccc
atcgcgcgtgacagcgtcggcccatggcaggaatttcccgagcttctggccgaaccctat
attcgcgggcgcgagctgaccaccgccgtgctgggcgatgaggcgctgctcgttaccgag
ctgcgccccaagagcggcttctatgatttcgacgccaaatataccgacggcatgaccgaa
catgtctgtccggcggagataccggacgagatcacgcaggcatgcaaggcgatcgcgctc
aaggcgcaccagctgcttggctgcaagggcgcgtcgcgctccgacttccgctgggacgac
agccagggcgtcgaggggctttacctgctggaggtcaatacccagccgggcatgaccccc
ttgagcctggtgccggaacaggcgaaaaagcttggcatcgaatatgccgagctggtcgag
cggatctgcgaggaagcattgacgagggggccgaacatgggggctggcaatggctga

DBGET integrated database retrieval system