KEGG   Sphingobium yanoikuyae: A6768_18430Help
Entry
A6768_18430       CDS       T05170                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sya  Sphingobium yanoikuyae
Pathway
sya00620  Pyruvate metabolism
sya00680  Methane metabolism
sya01100  Metabolic pathways
sya01120  Microbial metabolism in diverse environments
sya01200  Carbon metabolism
Module
sya_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6768_18430
  09102 Energy metabolism
   00680 Methane metabolism
    A6768_18430
Enzymes [BR:sya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A6768_18430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATI81783
UniProt: A0A291N343
LinkDB All DBs
Position
complement(4006271..4008973)
Genome map
AA seq 900 aa AA seqDB search
MESINPAQSAPAITQNPDIRYLGRLLGDVIRAYGGEKLYKQTEYIRSASVDRARGLQGAD
LTDTGLDALNLDDTLNFTRGFMLFSMLANLAEDRQGVAAEPGADVASAVAKLESHGIGKD
AVLELLSHSLIVPVLTAHPTEVRRKSMIDHKNRIADLMQLKDAGRTETDDGENLDEAIFR
QIALLWQTRPLRREKLFVQDEIDNVLTYFRDIFLPTLPALYGRWERVLGARPHSFLRVGN
WIGGDRDGNPFVQAPQLRSALGRGCEAALAYYMESIHALGAELSVSTELAHVPEAVLALA
EASGDTSPSRQDEPYRRAISGIYARLATTYVHLVGKAPPRPSALKGEPYAAPGDFRRDLV
TVAQGLASEGDGALSTGGALGRLIRAVETFGFHLATLDMRQNSDVHQRVVAELLKVAGVE
TDYAGLDEFARIALLRRELATNRPLGTRFSEYSEETASELAIVHAAAEAHRTYGPQCITH
YIISKAESVSDMLEVNILLKEAGLWRAPENGDPAKAAIMSIPLFETIGDLEAAPKIMTAY
FGLPEIAGVVQARGHQEVMIGYSDSNKDGGYITSTWSLYKASQALEPVFAEAGAAMQLFH
GRGGAVGRGGGSAFKAIQAQPRGSVQGRIRITEQGEVIAAKFGTRDVAMTNLEAMTSATL
LASLEPEGVSAKDAARFAAAMDELSKNAFTAYRDLVYGTEGFKEFFRQLTPIQEISGLKI
GSRPASRTKSTAIEDLRAIPWVFSWAQARVMLPGWYGFGHAIAAFEDKALLADMAQHWSF
LQSALANLEMVLAKSDLGIAARYLPLVEDQAKAETLFGRIREGWSLTHDGLLAATGQSRL
LERSPTTETSIRLRLPYIEPLNLLQVELLKRYRAGEDDARIKEGIELSINAIATALRNSG
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggagagcataaaccccgcccaatccgcgcctgcgatcacgcagaatcccgacatccgt
tatctgggacgcctgctgggcgatgtcattcgggcctatggcggggagaaactctacaag
cagaccgaatatatccgctccgcctcggtcgaccgcgcgcgcgggctgcagggcgccgac
ctgaccgacacgggcctggatgccctcaatctcgacgacacgctcaacttcacccgcggc
ttcatgctgttctcgatgctcgccaatctggccgaggatcggcagggcgtggcggcggaa
cccggcgccgatgtcgcgtcggcggtggcgaagctcgaatcgcatggcatcggcaaggat
gcggtgctggaattgctgtcgcacagcctgatcgtgccggtgctgaccgcccacccgacc
gaggtgcggcgcaagagcatgatcgatcacaagaatcgcatcgccgacctgatgcagctc
aaggatgccggacggaccgagacggatgatggcgagaatctggacgaggcgatcttccgc
cagatcgcgctgttgtggcagacgcggccgctgcgccgcgagaagctgttcgtgcaggac
gagatcgacaatgtcctgacctatttccgcgacatcttcctgccgacgctgccggcgctc
tatggccggtgggagcgggtgctgggcgcgcggccgcacagcttcctgcgggtcggcaac
tggatcggcggcgaccgtgacggcaacccgttcgtccaggcgccgcagctgcgatcggca
ctggggcgcggctgcgaggcggcgctggcctattatatggaatcgattcatgcgctgggc
gcggaactatcggtctcgaccgaacttgcccatgtgcccgaagctgtgctggcgctggcg
gaggcgagcggcgacacgtcgcccagccggcaggatgagccctatcgccgggccatttcg
ggcatctatgcgcggctggcgaccacctatgtccatctggtcggcaaggcgccgccgcgc
ccgtcggcgctgaagggcgagccctacgccgcgccgggcgatttccgccgcgacctcgtc
accgtggcgcaggggttggcgagcgaaggcgatggcgcgctgtcgaccggcggcgcgctc
ggccggctgatccgcgcggtcgagacattcggcttccatctcgccacgctcgacatgcgg
cagaatagcgacgtgcatcagcgcgtggttgccgaactgctgaaggtcgccggggtcgag
acggattatgccgggctggacgaatttgcgcgcatcgccctgttgcgcagggaactggcg
accaaccggccgctcggcacgcgcttttcggaatattcggaggagacggcgtcggagctg
gcgatcgtccatgccgccgccgaggcgcaccgcacctatgggccgcagtgcatcacccat
tatatcatttccaaggccgaaagcgtgtccgacatgctggaggtcaatatcctgctgaag
gaggcgggcctgtggcgcgcgccggaaaatggcgacccggccaaggcggcgatcatgtcg
atcccgctgttcgagacgatcggcgaccttgaggccgcgcccaagatcatgaccgcctat
ttcggcctgcccgaaattgccggggtggtgcaggcgcgcggccatcaggaagtgatgatc
ggctattccgacagcaacaaggatggcggctacatcacctcgacctggagcctctacaag
gcgagccaggcgctggagccggtctttgccgaggccggggcggcgatgcagctgttccat
ggtcgcggcggcgcggtcgggcgcggcggcggctccgccttcaaggcgatccaggcgcag
ccgcgcggcagcgtgcaggggcgcatccgcatcaccgaacagggcgaggtgatcgccgcc
aagttcggcacgcgcgacgtggcgatgaccaatctggaggcgatgaccagcgcgaccctg
cttgccagcctggaacccgagggcgtgtcggcgaaggatgccgcccgctttgccgcggcg
atggacgagctgtcgaagaacgccttcaccgcctatcgcgatctggtctacggcaccgag
gggttcaaggaattcttccgccagctgactccgatccaggaaatctccggcctcaagatc
gggtcgcgtccggcgagccggaccaagagcaccgcgatcgaggatctgcgcgccattccc
tgggtgttcagctgggcgcaggcgcgcgtgatgctgccgggctggtatggtttcggccat
gcgatcgccgcgttcgaggacaaggcactgctggccgacatggcgcagcactggtccttc
ctccagtcggcgctggccaatctggagatggtgctggccaagtcggacctgggcattgcc
gcccgatacctgccgctggtcgaggaccaggccaaggcggaaacgctgttcggccgcatc
cgcgagggctggtcgctgacccatgacgggctgctggcggccaccggccagtcgcgcctg
ctggaacggagcccgacgaccgagacgtcgatccggctgcgacttccctatatcgagccg
ctcaatctgctgcaggtcgaactgctcaagcgctatcgcgccggcgaggatgatgcccgg
atcaaggaaggcatcgaactgtcgatcaacgcgatcgcgaccgcgctgcgcaacagcggc
tga

DBGET integrated database retrieval system