KEGG   Sphingobium yanoikuyae: A6768_19740Help
Entry
A6768_19740       CDS       T05170                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
sya  Sphingobium yanoikuyae
Brite
KEGG Orthology (KO) [BR:sya00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sya02000]
    A6768_19740
Transporters [BR:sya02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    A6768_19740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_23 SbcCD_C SMC_N AAA_22 AAA_29 cobW AAA_30 NACHT T2SSE AAA_24 AAA_27
Motif
Other DBs
NCBI-ProteinID: ATI83425
UniProt: A0A085K3H3
LinkDB All DBs
Position
complement(4263200..4264165)
Genome map
AA seq 321 aa AA seqDB search
MIGDTPAPAAPYAVEGHALVKAFGDFRAVDGVDIAVPAGTIYGILGPNGAGKTTLLRTLL
GIIDPDEGHRTLLGDGAPLRMAKQVGYLPEERGLYPSMKAYEAIAFMGALRGLPLHVGRE
RARAMLQDYGMGASVEKPIRQLSKGMAQTVQLFGTIVHEPRLIVLDEPFSGLDAMNQEKL
EALIRDQARKGVTILFSTHVIAHAERLCERIAIVAGGRIRFEGSVSDARDRLPPQVTLRT
RLSDGAWRRALPTDTLAQDGAWHFALPDDGIEPLLRALLDGQAGIESLSIERPGLHDAFV
AIAGEAAARQMRDDATQEAGA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtgacactccggctcctgccgccccctatgccgtcgaaggccatgctcttgtc
aaggcgttcggcgattttcgcgcggtggatggcgtcgacatcgccgtgcccgccggcacc
atctatggcattttggggccgaacggcgcgggcaagaccaccttgctgcgcaccctgctc
ggcatcatcgaccctgacgagggccaccgcaccctgctgggcgatggcgcgccgctgcgc
atggccaagcaggtcggctatctgcccgaggagcgcggcctctacccgtcgatgaaggct
tatgaggcgatcgccttcatgggcgcgctgcgcggcctgccgctccatgtcgggcgcgaa
cgggcgcgcgccatgctccaggactatggcatgggcgcctcggtcgaaaagccgatccgc
cagctctccaagggcatggcccagacggtgcagctattcggcaccatcgtccatgaaccg
cgcctcatcgtccttgacgaacccttttccggcctcgacgcgatgaatcaggaaaagctg
gaggcgctgatccgcgatcaggcgcgcaagggcgtcaccatcctcttttccacccatgtc
atcgcccatgccgaacgattgtgcgaacgcatcgccatcgtcgcgggcggccgcatccgg
ttcgaaggatcggtcagcgacgcgcgcgaccgtctgccgccccaggtgacattgcgcacg
cggctgagcgacggcgcctggcgccgcgccttgccgaccgatacgctggcgcaggatggc
gcctggcatttcgcgctgcccgatgatggcatcgaaccgctgctgcgcgccctgctcgat
ggtcaggccggcatcgaaagcctatcgatcgaacgaccgggcctgcatgacgccttcgtc
gcgatcgcgggggaggctgctgcgcgccagatgcgcgatgacgccacgcaggaggccggg
gcatga

DBGET integrated database retrieval system