KEGG   Sphingobium yanoikuyae: A6768_20210Help
Entry
A6768_20210       CDS       T05170                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
sya  Sphingobium yanoikuyae
Pathway
sya00630  Glyoxylate and dicarboxylate metabolism
sya01100  Metabolic pathways
sya01120  Microbial metabolism in diverse environments
sya01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sya00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A6768_20210
Enzymes [BR:sya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     A6768_20210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ATI82093
UniProt: A0A291N3Z9
LinkDB All DBs
Position
4358903..4360171
Genome map
AA seq 422 aa AA seqDB search
MSDRVFATYEIETAFPLEQAAATMAGEQSTGTFVRVPGETDELREAHAARVEALEELGEV
SAPSLPGSGLPKNGGDGKRRRARVTLSWPTSNFGLSLPNLLATINGNLSELKAFSGLRLV
DVTLPPAFLTRYQGPQFGVAGTRRLAGVYDRPMIGTIIKPSVGLSPEATAEQVRALVEAG
VDFIKDDELQADGPHCPFEARISAVMRVINDHADKTGKKVMFAANLTGEMDEMLARHDHV
LREGGTCIMASMNSIGLPAMKMLRAHAQLPIHGHRNGWGMLGRSPAIGMSYIAFQKLWRL
AGIDHTHVNGIDNKFCESNESVIASARECLTPMFPAPHAGCEIMPVFSSGQSARQVPATF
AALGSTDLIFAAGGGIMAHPGGPGAGVRALQQAWEAAVAGVDQAEAASQAPELRDALAAF
AG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccgggtttttgccacttacgagatcgagacggcctttccgctggaacaggcg
gcggcgacgatggcgggcgagcagtcgaccggcaccttcgtccgcgtgccgggcgagacg
gacgaactgcgcgaggcccatgcggcgcgggtcgaggctttggaggaattgggcgaggtt
tcggcgccttcgctgccgggatcgggcctgcccaagaacggcggcgacggcaagaggcgg
cgggcgcgggtgacgctgtcctggccgacatccaatttcggcctgtcgctgcccaacctg
ctggcgacgatcaatggcaatctgtcggagttgaaggccttttccgggctccggctggtg
gacgtaacgctgccccccgccttcctgacccgctatcaggggccgcaattcggcgttgca
gggacacgcaggctggcgggcgtctatgaccggccgatgatcggcacgatcatcaagccg
agcgtcggcctgtcgcccgaggcaacggccgagcaggtgcgggcactggtcgaggccggg
gtcgacttcatcaaggatgacgaattgcaggcggacgggccccattgcccgttcgaggcg
cggatcagcgcggtgatgcgcgtcatcaacgatcatgccgacaagaccggtaagaaggtg
atgttcgccgccaacctgaccggcgagatggacgagatgctggcgcggcacgaccatgtg
ctgcgcgaaggcggcacctgcatcatggcgagcatgaacagcatcggcctgccggcgatg
aagatgctgcgcgcccatgcccagttgccgatccacggccaccgcaatggctggggcatg
ctggggcggtcgcccgccatcggcatgagctatatcgccttccagaaattgtggcggctg
gccggaatcgaccacacccatgtgaacggcatcgacaataaattctgcgagagcaacgag
agcgtgatcgcgtcggcccgcgaatgcctgacgccgatgttcccggcgccccatgccggg
tgcgagatcatgccggtcttctcgtccggccagtcggcgcgacaggtgccggcgaccttc
gccgcactgggatcgaccgacctgatctttgcggcgggcggcggcatcatggcgcatccg
ggcggtccgggcgcgggcgtgcgcgccctgcaacaggcctgggaggcggccgtggccggg
gtcgaccaggccgaagcggcaagccaggcgcccgaactgcgcgacgcgctcgccgccttc
gctggatga

DBGET integrated database retrieval system