KEGG   Sphingobium yanoikuyae: A6768_23480Help
Entry
A6768_23480       CDS       T05170                                 

Gene name
cobT
Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
sya  Sphingobium yanoikuyae
Pathway
sya00860  Porphyrin and chlorophyll metabolism
sya01100  Metabolic pathways
Module
sya_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:sya00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A6768_23480 (cobT)
Enzymes [BR:sya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     A6768_23480 (cobT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT
Motif
Other DBs
NCBI-ProteinID: ATI82665
UniProt: A0A291N5Z9
LinkDB All DBs
Position
5071800..5072813
Genome map
AA seq 337 aa AA seqDB search
MSFASITDFENALANLPPAEELASAAARARQAELTKPFGALGRLEDVAIFMASWQGRAVP
RLKRARAAIFAGNHGFTVHGVSAYPAAVTAQMVANFAAGGAAINALAGVAGLELAVRSID
LDRPTADFTIAPAMTEEECLTALSIGAAAAEEDLDLLVVGEMGIGNSTAAAALSARSFGG
KVSDWVGPGTGVDGEGIARKIATIDRALAFHAAAPDSAFETLRRLGGRELAAIAGAVLRA
RQLGVPVLLDGFISCAAIAPLVAQVPAFADHCLAGHCSAEPGHGLLLERMGLEPLLRLDM
RLGEGSGAAVAANIVRAAVAAHSGMATFAEAAVSTAT
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgcctcgatcaccgatttcgaaaatgccctggccaatctgccgccggccgag
gaactggcgagcgcggcagcacgcgcgcggcaggccgagctgaccaagccattcggggcg
ctcggccggctggaggatgttgcgatcttcatggcgagttggcaggggcgcgcggtgccg
cgcctgaagcgggcgcgtgccgcgatctttgccggcaatcatggcttcaccgtccatggc
gtcagcgcctatcccgcggccgtgaccgcgcagatggtcgccaatttcgccgccggtggc
gcggcgatcaatgcgctggccggcgtggccgggctggagctggcggtccggtccatcgat
ctggacaggccgacggcggacttcaccatcgcgccggccatgaccgaggaggaatgcctg
acggcgttgtcgatcggcgcggcggccgccgaagaggatctggacctgctggtcgtgggc
gaaatggggatcggcaattcgaccgccgccgcagccctgagcgcgcgcagctttggcgga
aaggtcagtgactgggttggtcccggcacgggcgtcgatggcgaggggattgcgcgcaag
atcgcgacgatcgatcgcgcgctggccttccacgccgcagcgccggacagcgcctttgaa
acgctgcgccggctgggcgggcgcgaactggcggcgattgccggcgcggtgctgcgcgcc
cgccagctgggcgtgccggtgctgctcgacggcttcatcagttgcgccgcgatcgcgccg
ctggtggcgcaggtgccggcctttgccgaccattgcctggcaggccattgctcggccgaa
ccgggccatggcctgctgctggagcggatgggccttgaaccgctgctgcgtctcgacatg
cgattgggcgaaggcagcggtgctgccgtggcggccaatattgtccgtgcggccgtagcc
gcgcatagcggcatggcgacctttgccgaggcggcggtgtcgaccgcgacatga

DBGET integrated database retrieval system